current user: public

If you have questions about the server, please let us know.

Query: [C] COG1141 Ferredoxin, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MADFLPSPEQEDNRSGFEPELGGFLRDAPERSGFEPELGGILRQKGVYVDEITCIGCKHCAHVARNTFYIEPDYGRSRVIRQDGDAEEVIQEAIDTCPVDCIHWVDYTELKNLEEDRKFQVIPVVGYPVDHAVATTEKRRRKQKSKNKKSRYLast
1 -72.000[C] COG1141 Ferredoxin  ali  100  1MADFLPSPEQEDNRSGFEPELGGFLRDAPERSGFEPELGGILRQKGVYVDEITCIGCKHCAHVARNTFYIEPDYGRSRVIRQDGDAEEVIQEAIDTCPVDCIHWVDYTELKNLEEDRKFQVIPVVGYPVDHAVATTEKRRRKQKSKNKKSRY 152
2 -25.100[C] COG1146 Ferredoxin  ali follow..  16  33........................................KEIEWYPTIDYDKCVTCGICFVTCGRVFDFDKKEGKVIVARPY-NCMVACQTCMNLCPTGAISFPDASYIKKLVAQNKIVKKAFEIIKPLLAEDHLSPKETETKPE...... 138
3 -24.800[S] COG3592 Uncharacterized conserved protein  ali follow..  17  15........................................RGADVDIYFNTNICAHSGNCVKGNAELFNLDRKP-----IMPDNVPKEEAKRVIHTCPSGALQYIEK............................................. 77
4 -24.500[O] KOG0716 Molecular chaperone (DnaJ superfamily)  ali follow..  29  93LNEAYQLLSDPISRQAYDKEQAKLEEGYTGKPIYSVWCGPETEQRAAFVDEVKCVGCLKCALCAEKTFAIETAYGRARVVAQWADPESKIKEAIEACPVDCISMVERSDLAPLEFLMSKQPRGNVGERVSNVFVDVKKFQERYAKAMSRTT. 253
5 -24.100[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  23  106..........................................ARMVAVIDENNCIGCTKCIQACPVDAIVGATRAMHTV---MSDLCTGCNLCVDPCPTHCISLQPVAE........................................... 169
6 -23.300[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  19  40........................................DWRTFMPVIDESKCVKCYICWKFCPEPAIYIKEDGFVAI---DYDYCKGCGICANECPTKAITMVREEK........................................... 105
7 -20.400[C] COG1145 Ferredoxin  ali follow..  20  276........................................AHSSYLATVDTSRCIACGICMLRCPKAIKAKINREPASV---DAEKCLGCGVCVPTCPMEAIELVERDELLELPDGMTY................................. 352
8 -20.000[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  17  94.............................EKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPQAITIEAEERRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNGDKWESEIASNLQADH........ 214
9 -19.200[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  10  19LVMIFGHAFRKRDTLQYPEE----------PVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPGCISLQKAETYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEFKRQDLVYEKHDLLISGPGKNPDYNYYRVAGMAIAGKPK. 165
10 -17.500[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  17  64...................................PVNAITRVDGAVQLNESLCVSCKLCGIACPAPARISTLLDWVPGIRAIAVKCDLCSACVRMCPTKALHLVDNTDIARVSKRKRELTFNTD........................... 187
11 -17.300[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  23  92..............................................VVVDEDVCIGCRYCHMACPGAPQYNAEKGHMTKCDGCYSAEGKQPICVESCPLRALEFGPIEE........................................... 157
12 -16.100[C] COG1036 Archaeal flavoproteins  ali follow..  12  174..........................................NGVTDQIELLKCKGCGICKELCPNAIKGGPVEVLVRDVDMRNVEIVK-GITVLESPEAILELF............................................... 239
13 -15.800[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  16  267..........................................ALEVPEWISENCTMCNECAFVCPHA-EMRGKDGLRYRIQVSPMDCTGCNLCAETCPAKALVMKPFEEVAAKENP.................................... 363
14 -15.000[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  11  199................................................IDEEKCTKCDECVKICPS--------NAIEDYQINREKCVKCLGCSEACDYGAVKTFWVFGRDVSERIVE.................................. 260
15 -14.900[C] COG0348 Polyferredoxin  ali follow..  14  211.......................................GAKGLFRIKVEHRQCDNCMDCYNVCPEPQVLRDHAKKSESPLVLSKDCISCGRCIDVCPEKVFIFTTRFNHSVNHS..................................... 289
16 -14.500[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  10  157........................................SHEDRLKLDGLYECILCACCSTSCPSYWWNGDR--DNLEDPFRLYRCHTIMNCAQACPKG-LNPAKA............................................. 246
17 -14.400[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  17  3..........................................PKIAEVIDYDVCAACGACEAVCPGAVTVKKAAGIRDPNDLGYQVCEGCLTCSRVCPV..................................................... 67
18 -14.200[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  10  136...IKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWMIDSRDDFTEERLAKLQDPFSLMNCTRTCPKG-LNPGKA............................................. 262
19 -13.000[C] COG1140 Nitrate reductase beta subunit  ali follow..  15  210..............................................VLIDQDKCRGWRMCITGCPKKIYFNWKSGKSEKCI----EAGQPTVCSETCVGRIRYLGVLLY........................................... 275
20 -12.900[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  15  36................................................LSVQACYQCGTCTGSCPLIMRKLQLGLVDEVIKSDE-MCTTCYTCYERCPRGV................................................... 99
21 -12.400[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  21  141..............................................YRYDPDQCILCGRCVEACQQVLSIDWERSQPRVIWDDDSSCVSCGLCATVCPCNALM................................................. 207
22 -12.200[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  21  308.................................................EVLRCIRCGACLNTCP-AYRISPILGGYEEFKDLPSACSLCTACNQVCPVK-IPLAN.............................................. 380
23 -11.800[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  14  146..............................................ISHEMNRCIACYRCVRYYKDYLGVYGAHDNVYFGRPEDGESEFSGNLVEICPTGVFT................................................. 209
24 -11.700[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  13  589........................................EIEPIVAVTDSDVCGGCEVCIELCP---AISIEEGHANVNVA---LCKGCGTCVAACPSGAMDQQHFRTEQIMAQI.................................... 660
25 -11.100[C] COG2440 Ferredoxin-like protein  ali follow..  11  22........................................DPGRPHIKVRPHERPSANLLTHICPAKCYELNDKGQVET---TSDGCMECGTCRVLCEASG................................................... 81
26 -10.800[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  13  364........................................AETEMGLSEPEQSCIRCGLCVDACPAGLLPQQLYWFSRGEEHEKARNHNLFDCIEVCPSNLVQYYRQEKAEIRALDQESARAAEAKARFEAKQARLAREKLARELRHKQAA. 482
27 -10.700[C] KOG2282 NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit  ali follow..  22  169..............................................VKTIMTRCIQCTRCIRFASEIAGVDDLGGNDMQVGTYIEMSELSGNIIDICPVGALT................................................. 232
28 -10.500[Y] KOG2439 Nuclear architecture related protein  ali follow..  11  48..........................................QLEKVSITLSDCLACSGCITSSEEILLSSQSHSVFLKNWGKLSQQQDKFLVVSVSPQCRLSLAQYYGLTLEAADLCLMNFFQKHFQCKYMVGTEMGRIISISKTVEK... 154
29 -10.200[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali follow..  11  31................................................LSLSDCLACSGCVSADEAGRIVDTSYLRSKIYEETYREMATNHLIVSACP-GVVTYIERTAPYLIGYLSRKSPQQMAFSLVKGSRTVSVMPCQDKKLENGRDG. 191
30 -9.580[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  13  558......................................RRREGKIVTYKVTEDCTLCMECVNTCP---ALIFDGEKVSI---DQSLCVGCAVCAKICPNRAIKPAKSN............................................ 623
31 -9.420[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  10  398..........................................DIDEIIELASECTDCGWCQRVCPNSLPVMDAVKKAADGDAIEELCYTCGRCEQECERN.................................................... 462

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.