current user: public

If you have questions about the server, please let us know.

Query: [C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
1 -44.000[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali  100  1MNTLFGKAKEEARVISPKSVDEYPEAPITLGTTLVNFTGDWRTFMPVIDESKCVKCYICWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREEK 105
2 -30.800[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  31  106.........................................ARMVAVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAE 169
4 -28.900[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  29  100..................................PRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFE 179
5 -28.500[C] COG1145 Ferredoxin  ali follow..  34  278.........................................SSYLATVDTSRCIACGICMLRCPMKAIKAKINEPASVDAEKCLGCGVCVPTCPMEAIELVERDE 342
6 -27.900[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  25  251.........................SGAYPPGTAAYEKRGIALEVPEWISENCTMCNECAFVCPHAAIRPILTNRIQVSPMDCTGCNLCAETCPAKALVMKPFEE 356
7 -27.400[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  33  58................................................GEERCVACNLCAVACPVGCISLQKAEFFRINFSRCIFCGLCEEACPTTAIQLTPDFE 123
8 -25.400[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  25  551.DGVYLAGVAQGPKDIPDAVAQASGAAARAAIPMVKGEVEIEPIVAVTDSDVCGGCEVCIELCPFGAISI-EEGHANVNVALCKGCGTCVAACPSGAMDQQH... 650
9 -24.900[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  37  197.............................................PQIDEEKCTKCDECVKICPSNAIE-----DYQINREKCVKCLGCSEACDYGAVKTFWVF. 250
10 -23.300[C] COG1141 Ferredoxin  ali follow..  19  41.......................................ILRQKGVYVDEITCIGCKHCAHVARNTFYIEPDYGRSRVDGDAEEVIQEAIDTCPVDCIHWVDYTE 109
11 -21.700[C] COG2440 Ferredoxin-like protein  ali follow..  16  29..............................................KVRPHERPSANLLTHICPAKCYELNDKGQVETTSDGCMECGTCRVLCEASGEIVWNYPR 89
13 -21.200[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  31  3.........................................PKIAEVIDYDVCAACGACEAVCPIGAVTVKKAAEKGGGYQVCEGCLTCSRVCPV.......... 67
15 -20.100[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  20  538HDGVAVVIARQPCA-----------------ILWSRARRREGKIVTYKVTEDCTLCMECVNTCP---ALIFDGEKVSIDQSLCVGCAVCAKICPNRAIKPAKSN. 623
16 -19.400[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  26  142..............................................RYDPDQCILCGRCVEACQQETLSIDWERSQPANLSSCVSCGLCATVCPCNALM...... 207
19 -18.900[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  21  16.TTFSATIHALEGGVVADCDVDAPNLHILLKPQILKAEDFIASKKARIMPEKCSSCGLCYDLCRFGAVVAEDG--YYVDEKKCEGCAFCFNVCPERAIEMENVK. 116
21 -18.400[Y] KOG2439 Nuclear architecture related protein  ali follow..  12  15..................................................SPALACVKPTQVSGGKKDNVDQLEKVSITLSDCLACSGCITSSEEILLSSQSHSV 81
22 -17.800[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  22  308................................................EVLRCIRCGACLNTCPAYRQILGGYEEFKDLPSACSLCTACNQVCPVK-IPLAN... 380
23 -17.800[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  17  381........................KTAMKLAPIRKSLKKLPDIDEIIELASECTDCGWCQRVCPNSLPVMDSKLEEMAIEELCYTCGRCEQECERNI........ 463
24 -17.700[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  20  175.........................................EEREKLDGLYECILCACCSTSCPSQAYRWMIDSRDDFTEERCHTIMNCTRTCPKGAIAEIKKM. 269
25 -17.700[C] COG1600 Uncharacterized Fe-S protein  ali follow..  30  195.................................................EEGCGKCVACMTICPTGAIV----EPYTVDARRCIGCDDCQLICPWNRYSQLTDEA 270
26 -17.700[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  22  159.........................................EDRLKLDGLYECILCACCSTSCPSQAYRWLIDSRDEATGERCHTIMNCAQACPKGAIAEIKKM. 253
27 -17.000[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali follow..  14  10..............................................SFFADLPKDNKKCIKIGSPLALSLSD----------CLACSGCVSADEAGALSEDLSF. 57
28 -16.800[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  20  36...............................................LSVQACYQCGTCTGSCPSGRLGLVDEVIKSDELWMCTTCYTCYERCPRGV........ 99
29 -16.500[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  27  373................................................PEQSCIRCGLCVDACPAGLLPQEHEKARNHNLFDCIECGACAYVCPSN......... 429
30 -16.200[S] COG3592 Uncharacterized conserved protein  ali follow..  11  17.........................................ADVDIYFNTNICAHSGNCVKGNA-ELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEK.. 77
31 -13.800[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  37  2...........................................RIAILNKDKCQ-CSECEKYCPDETIVFEDDGKPVISEELCVGCGICINKCPFDAIMIIG... 68
32 -13.800[R] COG1453 Predicted oxidoreductases of the aldo/keto reductase family  ali follow..  19  272............................SLTEAELQLVSKVEQKYRQIMKVGCTGCQYCMP-CPSGVLSGAVSGGKPGMASQCVQCGQCLEKCPQH-IDIPTILE 374
33 -13.600[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  12  91.ESVVEWLMTNHPHDCPVCEENCHLQDMTVMTGHSFRRYRFTKRTHSHEMNRCIACYRCVRYYKDTDLGVYGAHDNVYGTLESEFSGNLVEICPTGVFT...... 209
34 -12.700[C] KOG2415 Electron transfer flavoprotein ubiquinone oxidoreductase  ali follow..  22  555........................................................GPEQRFCPAGVYEFVPVERLQINAQNCVHCKTCDIKDPSQNINWVVPE. 607
35 -11.900[C] COG0247 Fe-S oxidoreductase  ali follow..  25  269............................................SQLLDLYACVECGRCTNMCPATGTGKMLSPMDLILRLRCTTCRNCEDQCPVM......... 384
37 -10.800[C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA  ali follow..  21  370................................................GERAMVPIGAYERVMPLDIIPTDTDSAQALGCLELEDLALCTFVCPGKALDKIEKE. 445
38 -10.200[C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits  ali follow..  17  124.RSMWGINSCTAFLTCTTAVVDSPSITKALGDALAPYFKEESPAKLRIFVSGCAMCAFLVQVCPTGAHTLRREVKLVLLGEKCINCARCKENCDAFDYDPENV.. 272
39 -9.570[J] KOG2613 NMD protein affecting ribosome stability and mRNA decay  ali follow..  16  12.............................................QNAATLLCCNCGMCYD-CIKLTVDITQGIPREANISFCRNCE.................. 62
40 -9.210[S] KOG4376 Uncharacterized conserved protein  ali follow..  13  12.............................................................YCPYNKEHKMLRKKLQQHILKCR-----LMVCPFNSSHLIPEPQ 58

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.