current user: public

If you have questions about the server, please let us know.

Query: [C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MKQVAVISGKGGTGKTTFSATIHALEGGVVADCDVDAPNLHILLKPQILKAEDFIASKKARIMPEKCSSCGLCYDLCRFGAVVAEDGYYVDEKKCEGCAFCFNVCPERAIEMENVKTGDLYVSKTEWGYFVHARLKPGEENTGRLVTEVKNRAKEIAEESNAEFLIVDSAPGVGCPVMASLTGVDAAIIVTEPTVSGLSDMLRILELCEHFRIRPFVVVNKFDLNVNIASEIESYCSENGVEFAGRVPFDKAIPEQIANLNFPFSGKAADKMVEIWKKLREVLLast
1 -95.400[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali  100  1MKQVAVISGKGGTGKTTFSATIHALEGGVVADCDVDAPNLHILLKPQILKAEDFIASKKARIMPEKCSSCGLCYDLCRFGAVVAEDGYYVDEKKCEGCAFCFNVCPERAIEMENVKTGDLYVSKTEWGYFVHARLKPGEENTGRLVTEVKNRAKEIAEESNAEFLIVDSAPGVGCPVMASLTGVDAAIIVTEPTVSGLSDMLRILELCEHFRIRPFVVVNKFDLNVNIASEIESYCSENGVEFAGRVPFDKAIPEQIANLNFPFSGKAADKMVEIWKKLREVL 283
2 -48.400[D] COG3640 CO dehydrogenase maturation factor  ali follow..  17  6.MPKLIISGRGGSGKSTLVTLIAHTLKVLVVDSDESNIGLSGILGIEPAEKTLMDYLGGKPRVMKKLRSMIRDGETEP----------------------------FREKFDLESLSQEFVCWVGSLGLMQIGKIDHAMEGCACPMGAVTRDFLNHVRLEEDQWVLVDTEAGVEHFGRGIVEGADAVVMVVDPSSDAVLLAEKAAKLTHEADKRFGVILNKID--EETEPILTELLTSEGNEIKGVLPYSPAITKMNLKGESLGAYAVKNEVDEIIRELMK.. 262
3 -43.300[D] KOG3022 Predicted ATPase, nucleotide-binding  ali follow..  19  60.HKILVLSGKGGVGKSTFSAQLSFALAGMLMDIDICGPSIPKMLGLEGQEIHQSNLGWSPVYVE--------------------------DNLGVMSIGFMLPNSDEAVIWRGPRKNGLI------------------------------KQFLKDVYWGEIDYLVVDAPPGTSDEHISIVQGIDGAIIVTTPQEVSLIDVRKEVSFCKKVGVPVLGVVENMSGLSQPFSTQKECVGKWEYRFLGKFLWIHNFAKQLNKVSHALRIT................ 293
4 -37.600[D] COG2894 Septum formation inhibitor-activating ATPase  ali follow..  19  3.RIIVVTSGKGGVGKTTSSAAIATGLATVVIDFDIGLRNLDLIMGCERRVVYDFVNVIQGDAT-------------------------------------------NQALIKDKRTENLYILPAS------------QTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRREHLLLTRYNPGRVSRGSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVINADAGKAYADTVERLLGE. 249
5 -34.500[D] COG0455 ATPases involved in chromosome partitioning  ali follow..  15  41.KVISVTGGKGGVGKSNVTLGMAICMAVMVLDADLGLANVDVMLGIRPKR-------------------------------------------------------NLGHVLAGECELKDAIVEGPHGIRIIPATSGTQSMTELSHAQHVGLIRAFGTLEDEMDILLIDTAAGISDMVVSFSRAAQDVVVVVCDEPTSITDAYALIKLLEHQVQRFKIVANMVRSYREGRELFAKLTLNVSLELVACIPLDDNVRQAVKRQKIVVRSPAALAISSLANKALTW. 283
6 -33.500[U] COG4963 Flp pilus assembly protein, ATPase CpaE  ali follow..  12  11.RNIAFIGAKGGVGSSTIAHNCAFGISTILADMDLAYGTANIDFDQDPAQGMAEAVFSPERLDEVFLDRL----------------------LTKCSDHLSLLAAPSLLDRTYDLDRQAFLP-------------------------------ILEVLQRSAPVAVLDLPHQWCDWTRAVLAEADEVVITAVPDLANLRNTKNLFDALIKLRPLPHLVLNQVGMPKRPEITPADFLEPLEIEPIAIIPFDAQFGNAANSGRMISEMDEKSQTAETFSQIAHTI 249
7 -32.600[P] COG1348 Nitrogenase subunit NifH (ATPase)  ali follow..  17  1MRQVAI-YGKGGIGKSTTTQNLTSGLAIMVVGCDPKADSTRLLLGGLAQKTVLDTLREEGE---------------------------------------------------DVDLDTIMKTGFGNIKCVESGGPEPGVGCAGRGIITSINMLEQLGAEDELDYVFYDVLGDVVCGGFAMPGKAKEIYIVASGEMMAMYAANNISKGISKFGVRLGGIICNSRKVKNEKELLEAFAKELGTQLIYFVPRSHEVQKAEINKQTVPKDEQADEYRALAKAIDGN. 247
8 -26.500[D] COG1192 ATPases involved in chromosome partitioning  ali follow..  13  3.KIISTVNMKGGVGKTTLTVNLATCLAVLVLDLDSQISATLSLMAPHDFAAIRKKGKTLSYLLANAIQP--------PYSKLDIFDIICPEICQIEGLELI-----------GDIELYDEYLVSEKLHQAAIATENPNFETVWNKFEGTLIKEMLAPVLEEYDFVILDCAPGYNLLTRSGIAASDFYLLPARPEPLSVVGMQLLERRIEKLNINLIGVVLMSRYYNQVMRRVQTDFTPGQL-FQQSIPMDVNVAKAVDSFMPVPNTAGSKAFIKLTQEFLQKV 294
9 -18.900[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  21  2...............NTLFGKAKEEARVISPKSVDEYPEAPITLGTTLVNFTGDWRTFMPVIDESKCVKCYICWKFCPEPAIYIKEDVAIDYDYCKGCGICANECPTKAITMVREE....................................................................................................................................................................... 104
10 -17.400[D] COG0489 ATPases involved in chromosome partitioning  ali follow..  17  90CRVIGVISCLPNEGKSVVALNLAGLIATLVVDADIRNPGLSRMLTTRQSA--------------------------------------------------------VEVVLDEVPWTQAVKVDTRTKMGILPVSTSNQFAHSSELLSSSGMRKFIDSAREACDYIIVDLAPVVPVIDAKAFAPVDGFVFVTEWGKTPIQMVQNLMANEPQIANKTLIVLNKTDMT.......................................................... 267
11 -17.400[P] KOG2825 Putative arsenite-translocating ATPase  ali follow..  12  19.LKWIFVGGKGGVGKTTTSCSLAIQMSVLLISTD-PAHNLSDAFGTKFGKDARKVPGFD------------------NLSAMEIDPNLSIQEMTEQADQQNPNNPLSGMMQDLAFTIPGIDEA------------------------LAFAEILKQIKSMEFDCVIFDTAPGHTLRFLNFPTVLETFVCVCISEFLSLYETERMIQELTSYEIDTNIVVNQLLLDPNTTCPQCMARRKMQQKYLAQIEELYEDFHVVKVPQVPAEVRGTEALKSFSEMLVK.. 319
12 -17.100[C] COG1146 Ferredoxin  ali follow..  17  1.....................MAEAKNAPLIGKDALGREVRDLSKVPWWGVDRKEIEWYPTIDYDKCVTCGICFVTCGRRVFDFDKKVARPYNCMVACQTCMNLCPTGAISFPDAS....................................................................................................................................................................... 100
13 -15.800[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  29  109..........................................................VAVIDENNCIGCTKCIQACPVDAIVGATRHTVMSDLCTGCNLCVDPCPTHCISLQPVA....................................................................................................................................................................... 168
14 -15.100[P] COG0003 Oxyanion-translocating ATPase  ali follow..  14  1MR-VILMTGKGGVGKTSVAAATGLRCATLVLSTD-PAHSLADSFDLELGHEPRLVKENLWGAELDALMELEGNWGAVKRYITQVLQARGLDGVQAEELAILPGMDEIFGL----------------------------------------VRMKRHYDEADYDVLIIDSAPTGTALRLLSLPEV-SVRLVTNPEKMVLKESLRAHAYLSLYNVSTLVIANRIRWKSNQQVYKQEIYDNFHPLPVKEAPLFSE------------EMCGLAALERLKDTLYK.. 307
15 -14.000[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  21  71.....LLRGFAVTLAHIFKEPATINYPFEKGPLS--------------PRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEYDIDMTKCIYCGFCQEACPVDAIVEG.......................................................................................................................................................................... 175
16 -13.800[H] COG0132 Dethiobiotin synthetase  ali follow..  10  2LTRLFVTGTDTAVGKTVVSRALLQALSQNGRTAVGYKP-------------------------------------------------------VATESKETSEGLRNQDALILQASSSIELNYQEVNPYPLQGDVIHACTDTLINYEKMTEGLQCLS--AKADTVIVEGCGGWKVMMNDQRFYSDWVILVVGIKLGCINHALLTAQAIINDGLPLGWVANRINPGLAHYAETIAMLRDRAAPQLGQLPYLPRP.............................. 206
17 -12.800[C] COG1145 Ferredoxin  ali follow..  34  281..........................................................LATVDTSRCIACGICMLRCPMKAIKAKINASVDAEKCLGCGVCVPTCPMEAIELVERD....................................................................................................................................................................... 341
18 -12.300[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  19  11.............GTFTQLRSLVMIFGHAFRKDTLQYPEEPVYLPPRYRGRIVLTRDPD---GEERCVACNLCAVACPVGCISLQEFFRINFSRCIFCGLCEEACPTTAIQLTP......................................................................................................................................................................... 120
19 -12.200[R] COG0645 Predicted kinase  ali follow..  23  1.RFLAVTHGVSAVGKSQVAMRLVEALGAVRLRSDIERKRL................................................................................................................................................................................................................................................... 39
20 -11.300[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  21  3LPNILL-TGTPGVGKTTLGKELASKSGLKYINVG......................................................................................................................................................................................................................................................... 35
21 -11.100[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  17  24..KLILLNGGSSAGKTSLALAFQDLAAECWMHIGIDL...................................................................................................................................................................................................................................................... 58
22 -10.600[H] COG1492 Cobyric acid synthase  ali follow..  11  1MKGIMVQGTASDVGKSLICTALCRIFARRGYKVTPFKS---QNMSNNSYITVEGLEIGRAQGIQAEAAMEEASVYM-------------------------------NPILLKPRNDREAEIVCFGQAVDTVSGVKYRDGFYKRGLEAIKQALATLS--QSFDMVVIE---GAGSPVEVNLNDRELVILVADIERGGVFASLYGTLELLQPNERKRVIVNKFRGDPE-SSGVQWIEQHLGVPVLGVLPHLPGVRIEGEDSLSKGQVTSVLPRDQSIDIAVLDL 260
23 -10.500[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  13  1MKRPLIIGGPVGAGKTMLIERLTRYLSTKGYSMAAITNDIYTKEDA---------------------------------RILLNTSVLPADRIAGVETGGCPHTAIREDASMNFAAIEEM-----------------------------------CDKHPDLQLLFLE-SGGDNLSATFSPDLVDFSIYIIDVAQ-GEKIPRKGGQGMIKSDL---FIINKVDLAPYVGANVEVMKAD-----TLKSRGNKDFFV--------TNLKTDEGLKSVADWIEKRL 199
24 -10.500[H] COG1797 Cobyrinic acid a,c-diamide synthase  ali follow..  11  2QPRLVIAGTHSGVGKTTVTLGLMAAFVEKGNIVDYIDPSYHRAVTKRASRNLDSWMVSEDVVND-----------------------------------------------------------------------------------------IFIEGCNGADLSIIEGVMGFSTADISLLLQAPVLLVVAAAVVKGFQQLNEKVKIA-------GVILNGAGSERHAEMCSEAIKEACGIPALGYLKKGDVP-SIPERHLGLVPALERGEHDSLFSQLAAVV 213
25 -10.400[R] COG2403 Predicted GTPase  ali follow..  13  137KPSLKILGTGKRIGKTAVSAYAARLIHERQYNPCVVAMGRGGPEEPEIVHGDRIEITPEFLMEQSD---------------------------------------------KGVHAASDHWEDALMSRILTVGCRRCGGGMVGDVFITNMKRGAETANRLDADFVILE-GSGAAIPPVKS----NRHIVLVG----ANQPLINIKNFFGPFRIGLLVIVTMCEEPMAGDEKVREIVDF-----IESINPEAEVITTVFRPKPLGEIEGKNVL........... 351
26 -10.300[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  16  92.KPMILLVGQYSTGKTTFIRYL----------LESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVD---AKKQFRALSGFGNAFLNRFQCSTL-------PNQVLE---------------------------------------------------SVTIVDT-PGITGVLEWFAERVDRIILLFDAHKLDIDEFKRCIEALAGNEDKIRIVLNKSD-----MVDHQQLMRVYGLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDL 316
27 -10.200[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  15  142LNSVKVAK---AIAECDAVICCTHFKLHMQAGVGGSIKNVGVGC-VAKPSKFDIHMSDYPQIDEEKCTKCDECVKICPSNAI---EDYQINREKCVKCLGCSEACDYGAVKTFWVFGRDVSE----------------------RIVECTKGVFKVQKNFAYLNFLMDITPHCDCHPYSDLPVVPDLGIMASKDILAI-DRASVDLYRQAENLSGALLKDKKFWDWTDVEGMLNYAEKLE---LGTQNYR-EIS............................. 363
28 -10.100[G] COG3265 Gluconate kinase  ali follow..  24  3.GKCIIVMGVSGTGKSCVGQALALALGAKFIDGD......................................................................................................................................................................................................................................................... 35
29 -10.000[R] COG0857 BioD-like N-terminal domain of phosphotransacetylase  ali follow..  10  3.RIIMLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRAGGDAPDQTTTIVRANSTLPAAEPLKMSHVESL------------------------------------------------------------LSSNQKDVLMEEIIANYHANT--KDAEVVLVEGLVPTRKHQFAQSLNYEIIVFVMSQGTDTPEQLNERIELTGAKNTNIGVIINKLNAPVDEQGRPAKLQESSPLPVLGAVPWSFDLIAT--------------RAIDMARHLNATI 242
30 -9.940[R] KOG2486 Predicted GTPase  ali follow..  10  135LPEFALV-GRSNVGKSSLLNSLVRRKRLALTS-------------------------------------------------------------------------------KKPGKTQCINHFRI-----------------------------------NDKWYLVDL-PGYGKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCD-----KRKKKKNGGKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQLR 312
31 -9.720[R] KOG1533 Predicted GTPase  ali follow..  14  32TMYGVLVIGAPGAGKSTFCAGLTDIFSQTTINLDPANDTMAYAPDVNITEMITVNDVMDR-----------------------------------LGLG------PNGALKY-----------------------------CIETLGANCNWLLQKIEANHKKYLIIDCPGQLE-KVIRFLEKSGVRLCASDPSKF-ISVALSTLATMVTMEMPQVNCLSKADL........................................................... 206
32 -9.630[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  21  1..MLIAITGTPGVGKTTVAKLLAKKLNYEYVSLK......................................................................................................................................................................................................................................................... 32
33 -9.510[E] COG4917 Ethanolamine utilization protein  ali follow..  18  1MKRIAFV-GSVGAGKTTLFNALQ----------------------------------------------------------------------------------------------------------------------------GNYTLARKTQAVEFNDKGDIDTPPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIG--VSKRQIAVISKTDMPDADVAATRKLLLETGFE----------------EPMFELNSHDPQSVQQLVDYLASLT 146
34 -9.500[G] COG2074 2-phosphoglycerate kinase  ali follow..  13  90EPLIILIGGASGVGTSSIAFEVANRLGIRNMISTDMIREVMRKIVSRELLPSIYESSYTA------------------------------------------------------------YQSLRIPPPPELDEVLIGFRDHVESVSIGVEAVIERALTEGIS-IVIEGVHIVPGFIREDLVNKENVFVLTVSDENVHKGRFYSRCRQMWARRPLKRYISYFWAIRRIHRYIENQARKHGVPVIENIDVVTTI-------------------DSIIKSLTKTT 294
35 -9.500[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  17  1MNRFVIADSTLCIGCHTCEAACSETHRQHGLQ----------------SMPRLRVMLNEKESAPQLCHHCE-CAVVCPVNAITRVDGAVLNESLCVSCKLCGIACPFGAIEFSGSRPLDIPANANTPKAPPAPPAPARISTLLDWVPGIRAIAVK---------LCSFDEQGPACVRM-----TKALHLVDNTDIARVSKRKRELTFNTDFGD...................................................................... 190
36 -9.440[G] KOG3354 Gluconate kinase  ali follow..  31  14.KYVFVVIGPAGSGKTTMAKAVSEKLGFEYIEGDDLHPKANI................................................................................................................................................................................................................................................. 54
37 -9.370[R] COG3596 Predicted GTPase  ali follow..  14  40..VIGIM-GKTGAGKSSLCNALFAGEVSPVSDVA----------------------------------------------------------------------------------------------------------------ACTRDPLRFRLQIGEHFMTIVDL-PGVGESYREQLPRLDLILWLIKADDRALATDEHFYRQVEAYRHKMLFVISQSDKNILSTEQKQNISRKICLLHELFQPVHPVCAVSVRLQW---------GLRVMAERMIKCL 216
38 -9.300[K] KOG1534 Putative transcription factor FET5  ali follow..  13  2VKVAAFVCGVASSGKSTFCGALMSYMKSVLVNLDPAAENFEWEPTVDIRDLISIDDVMEE-----------------------------------LDYG------PNGGLIY-----------------------------CFEFLMENLDWLNEEIGDYDEDYLIFDMPGQIE-RHLQVTLNFRPCAVLVDRTKF-FAGVLSAMSAMVMMEVPHINLLSKMDL........................................................... 177
39 -9.230[F] COG2019 Archaeal adenylate kinase  ali follow..  31  1..MRSVITGVAGVGKTTVLDIVARESGIPVVNYG......................................................................................................................................................................................................................................................... 32
40 -9.170[R] COG1160 Predicted GTPases  ali follow..  12  3TPVVALV-GRPNVGKSTLFNRLTRTRDALVADIDIDEADIVLFLDIGIANYLRQRQNKITVVVANKTDGIDADSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVELEEEQDKNIKIAIVGRPNVGKSTLTNRILGEDRVVVFDMPGTTRDSIYIPMERDGQQYTLIDT-AGVR-KTLQAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQDVKDRVKSELDRRLDFIDFARV---HFISALHGSGV--GNLFDSIKEAYACATQKM 392
41 -9.100[E] COG1703 Putative periplasmic protein kinase ArgK and related GTPases of G3E family  ali follow..  15  59......VTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVD------------------------SSPVTGGSILGDKTRMNDLARAEAAFIRPVPSSG------------------------------------------------ASQRARELMLLCEAAGYDVVIVET-VGVGQSETEVARMVDCFISLQIAGG-DLQGIKKGL-----MEVADLIVINKDDGD-------HTNVAIARHMYESALHILRRKYDEWQPRVLTCSALEKRGIDEIWHAIID.. 255

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.