current user: public

If you have questions about the server, please let us know.

Query: [N] COG1334 Uncharacterized flagellar protein FlaG, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MVNEVQGIGIPTSHASVQTTPTKEISRTNTINTVDESKTTIDPDQYKPKLELLSERLNEEMKRIGTDINFSYNDTIKGLVVSVKDANGDKVIREIPSKEAVELMQRMRDVIGIIFDKRGLast
1 -47.400[N] COG1334 Uncharacterized flagellar protein FlaG  ali  100  1MVNEVQGIGIPTSHASVQTTPTKEISRTNTINTVDESKTTIDPDQYKPKLELLSERLNEEMKRIGTDINFSYNDTIKGLVVSVKDANGDKVIREIPSKEAVELMQRMRDVIGIIFDKRG 119
2 -8.810[S] COG1728 Uncharacterized protein conserved in bacteria  ali follow..  15  71..............................................KGLVKRFVKEAVDSGLSHETSKSFDLYGNSRTLLVKEIDDKLIQLTEEMMDQE-IDLLERIGEIKGLLIN... 143
3 -7.320[L] COG1637 Predicted nuclease of the RecB family  ali follow..  13  110.............................................VEDHLQELLAEHITTLGDGYTLIRREYPTAIGPVDILCRNSDGETVAVEIKRRGGIDGVEQLTRYLELLNRDEL 183
4 -6.120[S] COG3519 Uncharacterized protein conserved in bacteria  ali follow..  14  23..................................ATEKPHLARFLAEKDADPDIERLLEGVAFLTGNLRQKIEDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSS........ 99
5 -5.770[S] COG4575 Uncharacterized conserved protein  ali follow..  10  30.......................................QSTADVAGDQAEEIRGKIHDSLKRARDTLRDTKDSLKDNVRERSQADATEVYVGEHP--QSIGIAAGVGFLLGLLVSRR. 109
6 -5.670[K] KOG3398 Transcription factor MBF1  ali follow..  10  77..................................................ERVPTELKKAIMQARTDKKLTQSQLAQIINEKPQVIQEYESGKAIPNQQIL---SKLERALGAKLRGK. 141
7 -5.460[J] COG0360 Ribosomal protein S6  ali follow..  12  15..............................................SEQVAGMIERYTGSITEAGRQLAYPINKLHKAHYVLMNVEADQAVVDEL--ETAFRFNDAVLRNMIMRTKAAI 96
8 -5.400[P] KOG3733 Mucolipidin and related proteins (TRML subfamily of transient receptor potential proteins)  ali follow..  1.MSRIFRSQASRSMRLEQIPLESMSRRSTTDRSDFNDNASNASSNASRRPTINFQEIMEDLPHHERETGERLRRHLQFFFMNPMEK---KVRHQLPYKLVLQVLKIVFVTMQLIL.... 112
9 -5.400[L] COG3695 Predicted methylated DNA-protein cysteine methyltransferase  ali follow..  3.................................................VSCAMRLHSGVFPDYAEKLSQEEKMEKEDSFPQRV-----QIVAAIPEGYVTT-YGDVAKLAG....... 60
10 -5.370[P] COG1965 Protein implicated in iron transport, frataxin homolog  ali follow..  12  7..............................................HRLADALWLTIEERLDSWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV................... 60

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.