current user: public

If you have questions about the server, please let us know.

Query: [NU] COG1677 Flagellar hook-basal body protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MAIESINAASVLPKVTLGETAKTDNATGAGNTFTQMLDSMSDTQSNAQTSVSNLLTTGEGNASDVLIQMKKAESEMKTAAVIRDNVIESYKQLLNMQVLast
1 -52.200[NU] COG1677 Flagellar hook-basal body protein  ali  100  1MAIESINAASVLPKVTLGETAKTDNATGAGNTFTQMLDSMSDTQSNAQTSVSNLLTTGEGNASDVLIQMKKAESEMKTAAVIRDNVIESYKQLLNMQV 98
2 -6.580[G] KOG2670 Enolase  ali follow..  18  349...............................SVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIE. 414
3 -6.510[G] COG1447 Phosphotransferase system cellobiose-specific component IIA  ali follow..  38..............................EQIKNAEAALLEAHHSQTSLIQGEARGEKAEVSLLLVHAQDHLMNAITFKDLAKEIVDLYRS...... 99
4 -6.220[N] COG1815 Flagellar basal body protein  ali follow..  44...........................NFQKVFDEALSNTRLQAKQTHRQTAYNHNGNNVDVDLEMTELAKNQIYYNALIERVNGNFNSLQTVIR... 129
5 -6.190[S] COG2361 Uncharacterized conserved protein  ali follow..  12  17..............................ERIEEYTEGLEREDFLSSNLVQDGTIGEATKHLSRDFREKNPQVSWKDIAGMRDRLIHHYFGV..... 85
6 -6.010[S] COG2445 Uncharacterized conserved protein  ali follow..  15  79.............................................................LSRLGIISGDLAERLAQMAKFRNMLVHVYWRI..... 110
7 -5.920[G] COG0148 Enolase  ali follow..  16  347...............................TLSETLETISLATRHSYRSVISHRSGETEDTTIADLAVATRVGQIKTGSLCRSERVAKYNRLLRIE. 412
8 -5.740[S] COG0327 Uncharacterized conserved protein  ali follow..  11  6................................LEQILNHKLNSQAISDYAPNGLQVEGKKDIKKIITGVTASQALIEYAVSQNADAILVHHGYF.... 67
9 -5.480[P] COG3853 Uncharacterized protein involved in tellurite resistance  ali follow..  12  307.................................QQAVAAQRQVSETTNELLKRNADMLKTNAIETARENERGIVDIETLKETQSSLIETLQETLKIQ. 370
10 -5.370[S] COG1992 Uncharacterized conserved protein  ali follow..  10  78........................................................GASSHTARKILALVGKDPNARSAMNIKPELVERARAL..... 116

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.