current user: public

If you have questions about the server, please let us know.

Query: [C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .
# Score Template Links and tools%idFirst MITIKKGLNLPISGSPEQVIRDGNAITEVALLGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVVFTAPASGTVTAIHRGAKRVLQSVVIKIEGNEQITFEKYTTEQLNQLTSEQVRQNLQASGLWTALRTRPFSKVPAVDATPVSIFVNAMDTNPLCADPQVIVQQSAQAFEAGLTVLSRLHEGKVYLCKAANASIPSPSIANLDVKEFAGPHPAGLSGTHIHFIDPVSATKFVWYINYQDVIAVGKLFTTGELDVSRVVSLAGPQVKNPRLVRTVLGANLSQLTANEVKDGENRVISGSVLSGAKAAGPVDYLGRYALQVSVLEEGREKEFLGWIMPGANKYSLSRTVLGHFSKKLFNFTTALNGGERAMVPIGAYERVMPLDIIPTLLLRDLAAGDTDSAQALGCLELDEEDLALCTFVCPGKNEYGPLLRQALDKIEKEGLast
1 -127.000[C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA  ali  100  1MITIKKGLNLPISGSPEQVIRDGNAITEVALLGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVVFTAPASGTVTAIHRGAKRVLQSVVIKIEGNEQITFEKYTTEQLNQLTSEQVRQNLQASGLWTALRTRPFSKVPAVDATPVSIFVNAMDTNPLCADPQVIVQQSAQAFEAGLTVLSRLHEGKVYLCKAANASIPSPSIANLDVKEFAGPHPAGLSGTHIHFIDPVSATKFVWYINYQDVIAVGKLFTTGELDVSRVVSLAGPQVKNPRLVRTVLGANLSQLTANEVKDGENRVISGSVLSGAKAAGPVDYLGRYALQVSVLEEGREKEFLGWIMPGANKYSLSRTVLGHFSKKLFNFTTALNGGERAMVPIGAYERVMPLDIIPTLLLRDLAAGDTDSAQALGCLELDEEDLALCTFVCPGKNEYGPLLRQALDKIEKEG 446
2 -63.300[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  16  13IWDFDGGIHPPEMKLQSSPMRIAPLPDQLIIPLQQHLGPEGELRVRAGEQVLKGQPLTVGRGR-TVPVHAPTSGMITAIAHPSGLAELCVHITPDGEDRWREQQ-PWADYRQRDKMALLDRIHQAGIAGLGGAGFPTASKGGLNGIITLIINAAECEPYITADDRLMQEHADEVITGIHILRHLLQPQQVLIGIEDNKPEAIAADDIHLRVVPTKYPSGGAKQLTKILTGKEVPFGVLMQNVGTVVAIKRAVIDDEPLIERVVTLTGDALSSPGNFWARIGTPVLYLLKGFKPQNPPMVIMGGPLMGFTLPSLDVPIVKISNCILAPAET---------------------------------EMGLSEPEQSCIRCGLCVDACPAGLLPQQLYWFSRGEEHEKARNHNLFDCIE--CGACAYVCPSNIPLVQYYRQEKAEIRAL. 446
3 -18.600[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  10  94.....................................GIDAATQQART-ACLIGTAAHAGHARHLVDHLIERLGEDYKIDLGSNVDIEAPITRTVMGKRPATLGDLREVMDYAEEQ-MSHLLSACHT---------DSKDFESKAFHAGLMDDLTREVADLAQIVALDPKGDEDAPLVELGFGTIDTEKPVVLCIGHNVLLDENEMEDQVEVCGICCAAIDVTRAKVVGPLSKQLRFIRSGVADVIVVDEQCVRTDVLEEALSAVIATTDKMCLGLPDMTDEDPDKIVNDLINGNEGALILDPEKVGEVAVKTAMKLAPIRKSLKKLPDID----------------------------------EIIELASECTDCGWCQRVCPNSLPVMDAVKKAADGDLSKLEEMAIEECYT--CGRCEQECERNIPIVSMVTKAGERRVKD. 479
4 -18.000[C] COG1894 NADH:ubiquinone oxidoreductase, NADH-binding (51 kD) subunit  ali follow..  11  1....................................................................MTINSGTTKEIIRTPEMHPLTWDKQPVWLDEYRSKAGAEKALKGMAPTDVVNVVKDAGLKGRGGAGFSTGLKDDSMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVHLRLIVHTGAGRYICGEETALINSLEGRRAGKPTCVNNVETLCNVPAIIEHGVEWYQKLMGFSGR-VKNPGLWELPFGITAREILED---------YAGGMRDGLKFKA----WQPGGAGTDFLTADHLDLPMDFENIAKAGSRLGTALAMAVDHEIGMVSLVRN-SRESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSAIKYFRDEFEAG. 431
5 -15.100[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  18  37.................................................................................................................................................................................................................................................................................................................................................................................SVQACYQCGTCTGSCPSSYRTRLIMRKLQLGLVDEVKSDELWMCT--TCYTCYERCPRGVKIVDAVKAARNLAAKKG 116
6 -13.900[C] KOG2658 NADH:ubiquinone oxidoreductase, NDUFV1/51kDa subunit  ali follow..  11  89...........................................................................................................KDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGLKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEVYIHFGAGAYICGEETALLESLEGKQ-GCPTTVTNVETVAVSPTILRRGNNAGTKLFCISGH-VNKPCTVEEEMSIPLKELIER---------HCGGVRGGWDNLLAI--IPGGSSVPLIPKNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSY----SCGQCTPCREGTGWLWMIMERMKVGNAKLEEIDMLQEVTKEGHTICALGDAAAWPVQGLIRHFRPELERR. 472
7 -13.800[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  11  31....................................................................................................................................................................................................................................................................RIYRWNPDDGQNPRIDTYYIGPMVLDALLYIKNNIDPTLICGS-IDGTNTLACTKGMEEIKGTVKVYPLPHMPVVKDLVPDLSNFYAQHRSIEPWLKTVSSHEDRLKLDGLYECILCACCSTSCPS-LGPAVLLQAYRW---NLEDPFRLYRC--HTIMNCAQACPKGLNPAKAIAEIKKMMVERR 258
8 -12.600[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  10  41...............................................................................................................................................................................................................................................................KFAIYRWDPDKAGDKPHMQTYEVDLGPMVLDALIKIKNEVDSTLICGS-INGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLYECILCACCSTSCPS-LGPAVLMQAYRDFTEERLAKLSLYRCH--TIMNCTRTCPKGLNPGKAIAEIKKMMATYK 274
9 -12.200[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  15  24........................................................................................................................................................................................................................................................................................................................................................GHAFRKRDTLQYPEEPVYLPPRYRGGEERCVACNLCAVACPVGCISLQKAETEDGRWYPEFFRINFSRCI---CGLCEEACPPDFEMGEFKRQDL....... 132
10 -11.800[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  12  3..................................................................................................................................................................................................................................................LTMRIFTASRNGQLFGSHGARLLAAQRAEPKDIVEVPKGKELSMEFADITDRAASTMFFGELLRGFAVTLAHIFKEPATI----------------------NYPFEKGPLSPRFRGEHALRRYPSGEER-CIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCI---CGFCQEACPVD.................. 170
11 -11.300[C] COG1146 Ferredoxin  ali follow..  13  42.................................................................................................................................................................................................................................................................................................................................................................................DYDKCVTCGICFVTCGRRVF------DFDKKEGKVIVARPYNCMV--ACQTCMNLCPTGA................. 93
12 -11.100[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  10  9..........KFKPRINEEIQNDIMRKAVVMAQERIGANRQKMVEELGH-------------------WEEWREHAKEIRNHVIENLDAYLYQLSEKVIQNGGHVYFAATAEDATNYIKNVAKQKNAKKIVKS-------------KSMVTEEIGMNHVLEA-------------EGIKVVETDLGEYILQVAEDKPSHIVVPAIHKDRHQIRKVLAE------KLGYTGSDTPEEMTLFIRETIRNDFLEADIGVSGCNFAVAETGSVCLVTNEGNLRLATSLPKTHIAVMGME--RLAPTVLITLLARSAVGARLTGYNTWLTGPRLAGETD------------GPEEFHLVIVDNGRSKMLGSEFREVLRCIRCGACLNTCPA---PIGSVISPILGGYEEFKDL-PSACS--LCTACNQVCPVKIPLANLLLKHRRHIAESG 393
13 -10.800[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  18  114..................................................................................................................................................................................................................................................................................................................................................................................ENNCIGCTKCIQACPVD---------AIVGATRAMHTVMSDLCT--GCNLCVDPCPTHC................. 161
14 -10.800[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  21  49.................................................................................................................................................................................................................................................................................................................................................................................DESKCVKCYICWKFCPEPAIYI---------KEDGFVAIDYDYC--KGCGICANECPTK---------AITMVREE. 104
15 -9.930[C] COG1145 Ferredoxin  ali follow..  11......................................................EKLREKLNKAPIGLPKTVSGVEKELLS--DEEEAKIAVHMPFIRFTAEQLAERTGKSLEYVEKILNEMAKKGT-----------VWKGEKDGQTYYRLF----PVIVGFAETPFWPGPGKDPRQEKLARLWSQYRKEGFLDEIGDREHPIMRA---------PERDTISEKSEILPYE--------DAVKLVKERDYIAVGYCPCRVMARLVGEGCRHSIENCIHMGSVGKYMVEHGLADEAIEILRQSNREG----------------LVHLTERSKHVATICNCCSDCCVFFKAVHEAKHPNTIAHSSYLATVDTSRCIACGICMLRCPMK--------AIKAKINREPASVDAEKCL--GCGVCVPTCPMEAELPDGMTYVQELLADKG 361
16 -9.030[C] COG2440 Ferredoxin-like protein  ali follow..  10  14................................................................................................................................................................................................................................................................................................................................................................LYQNRYLVDPGRPHIKVRPHERPSANLLTHICPAKCY---------ELNDKGQVETTSDGCME--CGTCRVLCEASGEIVNYPRGGFGVLFKFG 99

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.