current user: public

If you have questions about the server, please let us know.

Query: [S] COG1849 Uncharacterized protein conserved in archaea, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MLEEELARKIERYFSIEEEALKKIRISPAEGSFLRKIAEDNMQMILSYYSDAKHFYAKGDLINAFAALNYSYGWIDAGVRLGIFDGAGDHRLFTLYELast
1 -61.300[S] COG1849 Uncharacterized protein conserved in archaea  ali  100  1MLEEELARKIERYFSIEEEALKKIRISPAEGSFLRKIAEDNMQMILSYYSDAKHFYAKGDLINAFAALNYSYGWIDAGVRLGIFDGAGDHRLFTLYE 97
2 -7.780[S] KOG3856 Uncharacterized conserved protein  ali follow..  10  1.MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMY---GNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSS 93
3 -5.850[U] KOG1586 Protein required for fusion of vesicles in vesicular transport, alpha-SNAP  ali follow..  18  5.......GKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQA.......................... 68
4 -5.440[U] KOG3028 Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1  ali follow..  16  135.........YNLYYLEKRRKKALRLLAGKNDTEILKEAFMALNTLSTKLGDNKFFC--GNKPTSLDALVFGY......................... 195
5 -5.420[O] KOG3259 Peptidyl-prolyl cis-trans isomerase  ali follow..  13  75..QEKITRTKEEALELINGYIQKIK----------SGEEDFESLASQFSDCSS-AFSRGQMQKPFEDASFA---LRTGEMSGPVFTDSGIHIILRTE 163
6 -5.220[S] COG4467 Uncharacterized protein conserved in bacteria  ali follow..  11...DGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLENTKLRERLSHLEHETVAKNPSKQRKDHLEGI-YDEGFHICNFFYGQRRENDEECMFCRE. 102
7 -5.180[T] KOG4244 Failed axon connections (fax) protein/glutathione S-transferase-like protein  ali follow..  16  200..............SALLRRITGSDIGFHSREDIINIGSEDLKAISKYLGNKHYFH--GFKPTKVDACIFSH......................... 255
8 -5.040[J] COG0268 Ribosomal protein S20  ali follow..  19  1.............MANHKSAEKRARQTIKKTERNRFYRTRLKNITKAVRE-----AANGNKNAANEALKVANKSIHAMVSRGFIK............ 68
9 -4.750[S] COG1895 Uncharacterized conserved protein related to C-terminal domain of eukaryotic chaperone, SACSIN  ali follow..  16  2...................................DELELRIRKAEKLVQDAKKEFEMGLYERCCSTAYYA.......................... 37
10 -4.740[R] COG5565 Bacteriophage terminase large (ATPase) subunit and inactivated derivatives  ali follow..  12  397......TNGVEAGLSDMLQRMQSGRWK------VFSTCTEWFEEFRLYHRKDGRIVKERD--DLISASRYA.......................... 453

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.