current user: public

If you have questions about the server, please let us know.

Query: [S] COG1931 Uncharacterized protein conserved in archaea, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MMAMFEEVEVEAYVYPTEDINKVKKAMLNLVPGLKFEAFDKGEYMILVGKTRDKRALQRLYELFRGQQILDTARMMLEEGYFGEEIIIKVHKQVAYAGKVNFNEESPLGPITITIRTKEPQKLMKWLAPRTKDGVPIELast
1 -77.900[S] COG1931 Uncharacterized protein conserved in archaea  ali  100  1MMAMFEEVEVEAYVYPTEDINKVKKAMLNLVPGLKFEAFDKGEYMILVGKTRDKRALQRLYELFRGQQILDTARMMLEEGYFGEEIIIKVHKQVAYAGKVNFNEESPLGPITITIRTKEPQKLMKWLAPRTKDGVPIE 138
2 -48.800[J] COG1325 Predicted exosome subunit  ali follow..  16  1MTLPVNSISARVIAHATEDEKKVLEALANVLGGFYAEGHHGNPITIFQVKIDRPKYLEHWRENIPEEERRRVWSDIERRVDDKGNLYLRFDKQSAYKGELRISDADDVVKVNLESYPASREGGIKTLER......... 146
3 -6.490[R] COG3607 Predicted lactoylglutathione lyase  ali follow..  2..........................................RMIFVNLPVKNIEVSKSFFTALGFSFNPEYSDDRTLCMIVEENIFVMLLQEDRFRDFIDIADAKQSTEVLTCLSAGSREEIDEMIATALASGGSS. 98
4 -5.790[C] KOG0752 Mitochondrial solute carrier protein  ali follow..  10  154GSYPFDLLRTVLASQGEPKVYPMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTYDTFKRWSMRYRSSSSSSTNPSDSLSSFQLFLCGLASGTVSKLVCHPLDVVKKRFQLNAYKNMFDGLGQ-RSEG.... 289
5 -5.070[G] COG3429 Glucose-6-P dehydrogenase subunit  ali follow..  11  1MIVDLPDTTT----------TAVNKKLDELREKIGAVAM--GRVLTLIIAPDSEAMLEESIEAANDASHEHPSRIIVTMRGDPYADRPRLDAQLRVGADAGAGE-----FVVLRLSGPLAGHADSVVIPFLLPDIPV. 120
6 -5.060[C] KOG0767 Mitochondrial phosphate carrier protein  ali follow..  13  179ALAPMEAAKVRIQTQPGY-ANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTF--AGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKG.... 310
7 -4.490[R] KOG2977 Glycosyltransferase  ali follow..  65......EKYLSLIVPAYNEELRLPAALEETMDQDRASRDKSFSFEVVIVDDGSVDGTKRVAFDFIRKYTIDNIRVIPLGKNQGKGEAIRKGMLHSRGQLLLMLDADGATKV------TDLEKLENQINAVARE..... 187
8 -4.460[S] COG4027 Uncharacterized protein conserved in archaea  ali follow..  27.......LKVSS-LGGGRRFSEVRDNLSKALEHPYVP---GEKEKELAQDISSELPHPSFVKILRTKKVRNMRVDELYNNIEDIKAKFRLG............................................... 110
9 -4.460[KT] COG3835 Sugar diacid utilization regulator  ali follow..  12  285.......................LPVLLLPLNEGWQGEQWRRVMQELQTQDKSGQLVKTLKGLFAANGNLNLCAQQL---IHRNTLRYRLEKITEITG-IETNSLLGLAELYIAYQLTSYD................. 379
10 -4.330[J] KOG1754 40S ribosomal protein S15/S22  ali follow..  10  1..................................................MTRSSVLADALNAINNAEKTGKRQVLLRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGD... 85

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 3 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.