current user: public

If you have questions about the server, please let us know.

Query: [S] COG1934 Uncharacterized protein conserved in bacteria, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MKSKNKISHLLLACSLLAASLSAFALTGDTEQPAEVKSDKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEGFGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAYLEQLDSNIKGDRITYLVKKQQMEAFSDKGKRVTTVLLPSQLQDKGPAASGQKKSKLast
1 -80.300[S] COG1934 Uncharacterized protein conserved in bacteria  ali  100  1MKSKNKISHLLLACSLLAASLSAFALTGDTEQPAEVKSDKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEGFGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAYLEQLDSNIKGDRITYLVKKQQMEAFSDKGKRVTTVLLPSQLQDKGPAASGQKKSK 181
2 -17.200[S] COG5375 Uncharacterized protein conserved in bacteria  ali follow..  49LKIILPLSAAIISLAFIAMEKPAVAGRNEKGIDYSMNADRALQDIANPNLMTLEKVLAADSVAQVIAQEGIFDRSTN-----TLKMTAPFDI-----NLSNGIQAKFQSADVDLKAGKMSSKEPVSIKTNDGSIVAQSIDIADNGKTITFSG----QVRARIAASNIKNEGK......... 235
3 -16.000[S] COG3117 Uncharacterized protein conserved in bacteria  ali follow..  14  92...........................RGNVQPWHIQSARAEVGPKGKEVELIDDVRVARTD-----------------------------------AKGQPSILTTTRLTVFPDKNYAQTEQAVKIDAANGVTTAVGMKAYLKDSRMHLLS----NVRGQHEVR................ 190
4 -15.200[M] COG1452 Organic solvent tolerance protein OstA  ali follow..  21  51........................EPTNPGQQPINVEADKLEAIN-GQKATYSGNVVVVQGKKRIAADNVT----------------------------------------LHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLEN-----TRYQFLCEPGRGEAVYVSKTGKAV 161
5 -13.000[S] COG3126 Uncharacterized protein conserved in bacteria  ali follow..  11  1MKPWQPKALWQIVGGAALAVSLTGCAHQSAEAPVAAPISTATVAASVAQSTVHGTVNIRERVALPPDAVVTVTLSDISLADAPSRVIAQKAV---------RTEGKQAPFTYSLPFNPSDIQPNARVIVSAAITRNGQLLFITDTIQEVINRGAGTQADLLLVPVPSVALEIVPAPAAAT. 171
6 -7.450[MP] COG3015 Uncharacterized lipoprotein NlpE involved in copper resistance  ali follow..  12  2VKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKP---------PQSWRGVLPCAD-SLFLEKD-------------------GTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDS----------KGEKSYYRAKGDALEMLDREGNPIE...................... 128
7 -7.430[P] COG3420 Nitrous oxidase accessory protein  ali follow..  13  1MVLPRLFRTAGIMSLLAAALCAGAQARQIDVAVGESVQAAIEKAEPGDVVRHEGAVVIDR-AIELTGEPGAVLDGLGTGNAITVNAPNAIVRGLEVHGSGDNLPDLHSGIFVSRTATGARVENNRL-GAADSIAIGNEVL......................................... 153
8 -6.790[ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain  ali follow..  12  1......MKKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPT-FESKNSQGELVGDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNETAGRIDAAFQDE................ 184
9 -6.590[C] COG4314 Predicted lipoprotein involved in nitrous oxide reduction  ali follow..  10  1MKLT----VTAILAATLFLAGCQKEEDTTMPSPYSLTADAMNVLEHPG---PKGQIILQDIPEPIWFSSAAFTMLPEEPRDVAAIYVSDMGAAPSWQEPGAENWIDAKKAFYVIGSKVRGGMG-----------AEEAVPFSSERAARDFAAKNGGRV....................... 150
10 -6.530[C] COG2218 Formylmethanofuran dehydrogenase subunit C  ali follow..  84.............................SAGEIEINGNHCGFGMKGGKVVINGDADSWLGC-EMAGGEIILNGSASYYVGAGYRGEACGMRGGKITVNGN----TKDYLGEHMCGGEILVKGDV----------GLLPAISNNGGKIVIEGNAT.......................... 197

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.