current user: public

If you have questions about the server, please let us know.

Query: [H] COG2104 Sulfur transfer protein involved in thiamine biosynthesis, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSDWATKICELRKPVRLEVVTAVQGGLast
1 -42.800[H] COG2104 Sulfur transfer protein involved in thiamine biosynthesis  ali  100  1MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSDWATKICELRKPVRLEVVTAVQGG 68
2 -11.400[H] COG1977 Molybdopterin converting factor, small subunit  ali follow..  19  29LQKFTSGQATIDCEAANVGQLIEALGKPRRFLNFYVNEEDIRFLEGTD--TALSAGDEVSIVPAVAGG 109
3 -11.100[O] COG5131 Ubiquitin-like protein  ali follow..  18  24........SLSNLGSTKLGSLIDYMGTVRPGIIVLVNDQDW--ELLEKEEYNLEEGDEVVFVSTLHGK 97
4 -11.100[O] KOG4146 Ubiquitin-like protein  ali follow..  18  24........SLSNLGSTKLGSLIDYMGTVRPGIIVLVNDQDW--ELLEKEEYNLEEGDEVVFVSTLHGK 97
5 -9.230[O] COG5227 Ubiquitin-like protein (sentrin)  ali follow..  13  36INLKVVGQDFKIKKTTEFSKLMARQGKSMNSLRFLVDGERIRPDQTPAEL-DMEDGDQIEAVLEQLGG 111
6 -9.070[O] KOG1769 Ubiquitin-like proteins  ali follow..  16  17INLKVAGQDFKIKRHTSLSKLMERQGLSMRQIRFRFDGQPINETDTPAQL-RMEDEDTIDVFQQQTGG 92
7 -8.710[S] COG2914 Uncharacterized protein conserved in bacteria  ali follow..  15  27........RVTLQEGATVEEAIRASGLLELRTDIDLTENKV--SRPAKLSDSVHDGDRVEIYRPL... 84
8 -8.010[O] COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family  ali follow..  22  10MFVKVNGEEVELPDGSTVRDALEATG-EGTLVCLISGTRELERTIDTYRIRTTTGSILLEL....... 73
9 -7.570[L] KOG0012 DNA damage inducible protein  ali follow..  16  1MKITVTTSCLDVAQDLELENLKAEIGAEVSQIAVIFNGRELSSDKQTLQQCGVGDGDFIMLERRRSAN 77
10 -5.870[J] KOG3401 60S ribosomal protein L26  ali follow..  10  1..MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKEL--RQKYNVRSMPIRRDDEVQVIRGHFKG 64

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.