current user: public

If you have questions about the server, please let us know.

Query: [R] COG2346 Truncated hemoglobins, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MHSPPRKAIRTAGSKEATMSSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADNPLast
1 -78.100[R] COG2346 Truncated hemoglobins  ali  100  1MHSPPRKAIRTAGSKEATMSSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADNP 151
2 -13.200[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  15  18................................VETGPKLTAHFYDRMTHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENLPALPAVEKIAQKHTSFQIKPEQYNIVGTHLLATLDEFNPGQEVLDAWGKAYGVLANVFIHREAE.. 137
3 -6.780[C] COG3005 Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit  ali follow..  321...................................................................................AYADSLYNGTCNQCHGAPDKAHFDANGWIGTLNGMIGFTSLDKREERTLLKYLQMNASDTTNTPHSD. 387
4 -6.220[S] COG1650 Uncharacterized protein conserved in archaea  ali follow..  108.HAYEPFECAFEATHHAPNTSLVSATFIEVGSTE------AEWRDKRAVGVLAQALEEALTKEFEGPTPTM-------IGDL-HYVTISDRGEFDLGHVVPKYINITTNIVENILKKHIFRKNIKNPIRTEIIELLRAKGIEVTLK..... 250
5 -5.940[R] KOG4530 Predicted flavoprotein  ali follow..  38GKRETNFDYEKVDLTDWPLSMSDEPGLPIMGIDVYTQEHTKAWGSKIAGADGFVFVTPQYNGGYPAILKNALDHLYHEWNGKPLHGGGDCASQLKHVAGFLKMRVAPTMPALTLPRDKIVQGVV-TKHLGELKKAFGEFSQLFESNPERKP 200
6 -5.770[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  71........................KFWD-VGGQESLRSMWSEYYSLC--HGIIFIVDSSDRERLDECSTTLQSVVMD-----EEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISALPISALTGEGVKDAIEWMIVRLERNKKSRP 194
7 -5.530[G] COG1264 Phosphotransferase system IIB components  ali follow..  11  5..ETAEGSEETSSEVKVAAGSQAVNIINLLGGRVNIVDVMTRLRVTVKDADKV.................................................................................................. 58
8 -5.510[C] KOG4631 NADH:ubiquinone oxidoreductase, NDUFB3/B12 subunit  ali follow..  6...............HEPFKIPNYSIYSNFRDFPQLAQHEKRLAQIGLKDPWIRNYVYLYDRKYPHVVGQWAHFKKLILPG...................................................................... 71
9 -5.510[P] COG3626 Uncharacterized enzyme of phosphonate metabolism  ali follow..  10  1.........................MYVAVGGEKAIDAAHALQESRRRGDTDLPEL------SVAQIEQQLNLAVDRVMTEGGIADRELAALALKQAS-----DNVEAIFLLRAYRTTLAKLAVSEPLDTTEMRLERRISAVYKDIPGGQ. 116
10 -5.380[H] COG0807 GTP cyclohydrolase II  ali follow..  10  24.........................GFEEAGGQEHVALTVGDCSDRIHSECLTGDALFSKKCDCGPQLEAAMKAVQAEGRGIIVYLRQEGR-GLINKIRAYHLQDQGMDTVEANVALGLPVDARDFRLAQSIYEYLGIRSVKLLTNNPEK. 155

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.