current user: public

If you have questions about the server, please let us know.

Query: [C] COG2440 Ferredoxin-like protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MTMAVTKLRVEEKLYQNRYLVDPGRPHIKVRPHERPSANLLALTHICPAKCYELNDKGQVETTSDGCMECGTCRVLCEASGEIVWNYPRGGFGVLFKFGLast
1 -60.000[C] COG2440 Ferredoxin-like protein  ali  100  1MTMAVTKLRVEEKLYQNRYLVDPGRPHIKVRPHERPSANLLALTHICPAKCYELNDKGQVETTSDGCMECGTCRVLCEASGEIVWNYPRGGFGVLFKFG 99
2 -28.700[C] KOG2415 Electron transfer flavoprotein ubiquinone oxidoreductase  ali follow..  20  512...GQISFDLLSSVALSGTNHEHDQPHLTLRDNRNLSIYDGPEQRFCPAGVYEFVPVERLQINAQNCVHCKTCDIKDPSQ-NINWVVPEGGGGPAYN.. 615
3 -25.500[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  18  55......................HQNVFAYYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGA.................. 113
4 -24.100[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  18  48...............................PQLCHHCEDAPCAVVCPVNAIT-RVDGAVQLNESLCVSCKLCGIACPFGAI................. 97
5 -21.700[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  16  47............................VIDESKCVKCYI--CWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREEK.......... 105
6 -20.100[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  15  111............................VIDENNCIGCTK--CIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHC.................. 161
7 -18.800[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  16  84KEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKL--CEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDA.................. 171
8 -18.800[C] COG1140 Nitrate reductase beta subunit  ali follow..  16  171.....................QFENTFMMYLPRLCEHCLNPACVATCPSGAIYKREDGIVLIDQDKCRGWRMCITGCPYKK.................. 231
9 -18.700[C] COG1146 Ferredoxin  ali follow..  13  33.....................KEIEWYPTIDYDKCVTC--GICFVTCGRRVFDFDKKEIVARPYNCMVACQTCMNLCPTGA.................. 93
10 -17.900[C] COG1036 Archaeal flavoproteins  ali follow..  11  132.............VPVDIEGSIISEMPYNIDRKQCRHCETCPPRENCPHGAITEKNGVTDQIELLKCKGCGICKELCPYNA.................. 199
11 -17.100[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  15  194........................SDYPQIDEEKCTKCDE--CVKICPSNAIE-----DYQINREKCVKCLGCSEACDYGAV................. 244
12 -16.700[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  22  59...............................EERCVACNL--CAVACPVGCISLQKAEFFRINFSRCIFCGLCEEACPTTA.................. 115
13 -16.600[C] COG1145 Ferredoxin  ali follow..  16  282...........................ATVDTSRCIACGI--CMLRCPMKAIKAKINEPASVDAEKCLGCGVCVPTCPMEAI................. 335
14 -14.700[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  15  272............................EWISENCTMCNE--CAFVCPHAAIRPILTNRIQVSPMDCTGCNLCAETCPAKD.................. 346
15 -13.800[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  16  8............................VIDYDVCAAC--GACEAVCPIGAVTVKKAAGIRGGYQVCEGCLTCSRVCP..................... 66
16 -13.500[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali follow..  16  2....................DALIRPPMSFFADLPKDNKK--CIKIGSPLA----------LSLSDCLACSGCVSADEAGAL................. 51
17 -13.300[C] COG0348 Polyferredoxin  ali follow..  15  207.......YGVIGAKGLFRIKVEHRQ--------QCDNCMD--CYNVCPEPQLHAKKSESPLVLSKDCISCGRCIDVCPEKV.................. 275
18 -13.200[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  16  375VGEVAVKTAMKLAPIRKSLKKLPDIDEIIELASECTDCGW--CQRVCPNSLPVMDSKLEEMAIEELCYTCGRCEQECERNIPI................ 465
19 -13.000[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  12  136HRSIEPWLKTVSPTPAKEWKQSHEDRLKLDGLYECILC--ACCSTSCPSQAYRWLIDSRDEATGERCHTIMNCAQACPKG................... 240
20 -12.900[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  12  7TVIREEDLNPDFLEELSELVEPVFEEEEVLSVQACYQC--GTCTGSCPSGRRTSYRTRLIMRKLQMCTTCYTCYERCPRGVKI................ 101
21 -12.800[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  16  158......KKKDESQEGKQQYLQSIEEREKLDGLYECILC--ACCSTSCPSQAYRWMIDSRDDFTEERCHTIMNCTRTCPKG................... 256
22 -12.400[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  14  364.....................AETEMGLSEPEQSCIRC--GLCVDACPAGLLGEEHEKARNHNLFDCIECGACAYVCPSNIPL................ 432
23 -12.400[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  17  552.............ILWSRARRREGKIVTYKVTEDCTLCMECVNTFACPA---LIFDGEKVSIDQSLCVGCAVCAKICPNRAIKP............... 619
24 -12.300[C] COG1600 Uncharacterized Fe-S protein  ali follow..  13  172........EAGSFFFLGELLIDLPLPVDQPVEEGCGKCVA--CMTICPTGAIV----EPYTVDARRCIGCDDCQLICPWNRYSQ............... 265
25 -12.000[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  16  131.................GYLNDFTHPFYRYDPDQCILCGR--CVEACQNETLSIDWERSQPANLSSCVSCGLCATVCPCNALME............... 208
26 -11.900[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  13  288..........EFHLVIVDNGRSKMLGSEFREVLRCIRC--GACLNTCPAYRQIGGHYEEFKDLPSACSLCTACNQVCPVKIPLA............... 379
27 -11.100[C] COG1141 Ferredoxin  ali follow..  11  41.....................ILRQKGVYVDEITCIGCKH--CAHVARNTFYIEPDYGRSRVDGDAEEVIQEAIDTCPVDC.................. 101
28 -11.100[Y] KOG2439 Nuclear architecture related protein  ali follow..  18  15................................SPALACVK--PTQVSGGKKDEPDQLEKVSITLSDCLACSGCITSSEEILL................. 74
29 -11.000[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  16  587...................EVEIEPIVAVTDSDVCGGC--EVCIELCPFGAISI-EEGHANVNVALCKGCGTCVAACPSGA.................. 645
30 -9.560[R] COG1453 Predicted oxidoreductases of the aldo/keto reductase family  ali follow..  12  262LKIASEAYPNSLTEAELQLVSKVEQKYRQIMKVGCTGCQY--CMP-CPSGVLSGAVSGGKPGMASQCVQCGQCLEKCPQHIDI................ 369
31 -9.280[S] COG3592 Uncharacterized conserved protein  ali follow..  11  1.......MEEETLLEQGYRKYRGADVDIYFNTNICAHSGN--CVKGNA-ELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGA.................. 71
32 -9.040[C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA  ali follow..  10  353.............LGHFSKKLFNFTTALNGGERAMVPIGA--YERVMPLDIIAGDTDSAQALGCLELDELALCTFVCPGKNEYG-PLLRQALDKIEKEG 446

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.