current user: public

If you have questions about the server, please let us know.

Query: [V] COG2602 Beta-lactamase class D, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKDTDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGVKREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITSLast
1 -110.000[V] COG2602 Beta-lactamase class D  ali  100  1MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKDTDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGVKREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS 267
2 -43.500[M] COG0768 Cell division protein FtsI/penicillin-binding protein 2  ali follow..  18  273.......AVVVTDPRTGGILALVSNPSYDPNLFVDGISNKD----------YQGLLNDTNRPLINRATQGVYPPASTVKPYIAVSALSAGVITKNTSLFDPGWYRDWKKWGHGRLNVTKALEESADTFFYQVAYDMGIDRLSSWMSKFGYGEWYQGDTIPVGIGQGYWTATPIQMAKSLMTLINDGGSINSGYWEIAKDGMYGVANRPYKAAAKSGTAQVLRDHKLMVAFAPYENPTVSVAIILENGGPAVGTITRQILDHI..... 609
3 -20.800[M] COG0744 Membrane carboxypeptidase (penicillin-binding protein)  ali follow..  13  316................TTVDANFQTMAEDTVKKWHKTLLGEGLSRNQIALVAIDPRTHFVKAL-NRATQALRQPGSSFKPFVYYAAFATGKFAPDSTVI-----RNYDGGFSGAMSIRTALAQSRNIPVIKLGKTIGMNKVVETCRILGIMSPM---EPVTSLPLGAIGVTPLEMASAYATFANYGW-LDPWASAAIIDVMRSVVTNGTPSAGKTGTTSSEKD-IWYVGTVP----QLTTAVWIATGGGKVAPIWRDFMTKA..... 619
4 -19.100[M] COG4953 Membrane carboxypeptidase/penicillin-binding protein PbpC  ali follow..  11  272..................ITTTLDAGLQRRLEELAQNWKGRLPPRSSLAMIVVDHTDMRVRGWHVDMVNSIRSPGSVLKPFVYGLALDEGLIHPASLLQ-----GNFDSGFHGPISMSEALVRSLNLPAVQVLEAYGPKRFAAKLRNVGLPL-PNGAAPNLSLILGGAGAKLEDMAAAYTAFARHGK-MSSGAAWIIRRIMADEAQPLAPLAWKTGTSYGYRD-AWAIGV----NARYVIGIWTGRGFASAVPLLNQVNNIL..... 564
5 -17.700[V] COG2367 Beta-lactamase class A  ali follow..  10  2.........................KLNRKMTMTVAEQLNAICDVQPFRFMVRNLLTGEEIGRGEN---EETPSGSTRKTSIMMIDLDQPVTYEKRLAEEVASGMFRYMTPGIVISLRDMMVLSDNVCTKMVLERLTLEEVDGYCKSLGMANTHHRFLIPPL-LKTVTTTSAADQVLLLQTILDAQS-CSPQLCEWAMQTLKNQIPFEAMVASKSGRGKRGRM----AGIVRNGAPSFIITTYTDEVPQVMPD-ALETIGRLA.... 279
6 -16.800[M] COG5009 Membrane carboxypeptidase/penicillin-binding protein  ali follow..  11  433.............................................VNSALVSLNPQTGAVLAL-NRATQALRQVGSNIKPFLYTAAMDKGMLNDVPISRWDAGAKNSPPQYAGPIRLRQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVHTESLAL--GSASFTPMQVARGYAVMANGGFLIDPYFISKIENWRAARDLKRRDIGGKTGTTNSSKD-AWFSGYGPGDDHRRDLGRTTEGGAKSAQPAWDAYMKAV..... 792
7 -11.200[M] COG1686 D-alanyl-D-alanine carboxypeptidase  ali follow..  13  1MNITTIAKRLSLLVLFIAPTAGWAAESMVPAPPQLAAK----------SYVLMDGESGQVLV--ENNGDQRLPPASLTKLMTAYIEIEAGRIGENDLVWRTGGSRMFIKVGSQSDLLHGIIIQSGNDASVALAEHIAADMMNTTAQKLGLTNSHFMDA--TGLPNPDHYSSARDMAVLARAIIYGEFLWNNIKQPNRNLLLWRDKTVD-----KTGHTDEAG----LVASAVRDGQRMIAVVFGTNSEQARAAETQKLLT....... 270
8 -9.490[S] COG5445 Predicted secreted protein  ali follow..  12  1MNWRRIVWLLALVTLPTLAEETPLQLVLRG----------------AQHDQLYQLSSSGVTKVSALPDSLTTPLGSLWKLYVYAWLEDTHQPEQPYQCRGNSPEEVYCCQAGESITRDTALVRSCGLYFAPQRLHIGADVWGQYWQQRQ----------APAWLASLTTLKPETSVTVKSLLDSATLPAQNKAQEVLLDVVL................................................................. 177
9 -9.370[V] COG1680 Beta-lactamase class C and other penicillin binding proteins  ali follow..  12  1MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYGSGATGMALVVIDGNQRVFRS-QLDSVVRIASLTKLMTSEMLVDQGTVKLNDPLSKYPPGARVPTYNGTPITLVNLATHTSQAAYSNLAANASGKPYTQLFEEVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYGFITYQKNIGAFVVVTRSPLTRFKNMSDGINDLV..... 371
10 -8.550[M] COG2027 D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4)  ali follow..  11  1MHFSRIVSGLACSIILNISVSNANAA-------QVENYTQYLPDGANLALMVQKIGASTPAI--DYHAQQMALPASTQKVLTALAALLDGVLRGNLIA-----------RFGGDPTLTRQ--------LRNMVATLGVKQIASVFASHDKAPGWPWNDMTQCFSAPSVSLYSAPNPGDTAFIRVA----SYYPVQMFSEVRTLAKGSPDAQYCELDVVPGELNRFTLTGCLTQRSEPLPLAFAVQNGASYAGAILKDELKKADI... 273

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.