current user: public

If you have questions about the server, please let us know.

Query: [K] COG2944 Predicted transcriptional regulator, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MTTSSWLSGSLPNSIARKTQAELVRKSGPAPYWRFAMATKRKFKSDAFEAIHSAVEDMYSAGTIDKETMKTFDETCLSIPQELTPSEIKALRENNHVSQPVFARYLNTSESTVQKWETGAKRPSGPALKLLSIVRKHGLEMLSLast
1 -73.400[K] COG2944 Predicted transcriptional regulator  ali  100  1MTTSSWLSGSLPNSIARKTQAELVRKSGPAPYWRFAMATKRKFKSDAFEAIHSAVEDMYSAGTIDKETMKTFDETCLSIPQELTPSEIKALRENNHVSQPVFARYLNTSESTVQKWETGAKRPSGPALKLLSIVRKHGLEMLS 143
2 -20.700[K] KOG3398 Transcription factor MBF1  ali follow..  22  84....................................................................................KKAIMQARTDKKLTQSQLAQIINEKPQVIQEYESGKAIPNQQILSKLE........... 131
3 -18.800[K] COG1709 Predicted transcriptional regulator  ali follow..  25  29....................................................................................GKTMRKWREIFGISQTELADYLGVSSSVISDYEGGRRKPGASTIRKF............ 76
4 -17.900[K] COG1476 Predicted transcriptional regulators  ali follow..  22  3.....................................................................................NNIKVYRAIHDLTQENLAEKVGVTRQTINAIEKGKYDPS-LAFKLSRLFKASVEDIF. 60
5 -17.400[K] COG1813 Predicted transcription factor, homolog of eukaryotic MBF1  ali follow..  10  110....................................................................................AERVMEAIRKSGLSYEELSHKVGLSVNLLRRIAHGEYTPTIEEARKLE........... 157
6 -16.500[K] COG4800 Predicted transcriptional regulator with an HTH domain  ali follow..  20  23.......................................................................................SAVIKEDLNLTAVDFAKKANIPPSTLYKILSGNRDPNKTLRQIVKTIR........ 71
7 -15.600[P] COG1513 Cyanate lyase  ali follow..  13  15....................................................................................ADAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPDAARLVGAKLDLDEDSILL 74
8 -15.300[K] COG1395 Predicted transcriptional regulator  ali follow..  19  126.................................................................................SIEGDLLKKARTDQSMSLGTLASMVGVSRRTISKYEEEGMDASDVVLQLEDIFGVELARPI. 187
9 -15.200[R] COG2522 Predicted transcriptional regulator  ali follow..  20  17...............................................................................FPSIRASIAKILVEEYKMSKYSVAKMLGATPTAVSYYISGKRGEK................... 61
10 -14.400[K] COG1396 Predicted transcriptional regulators  ali follow..  28  2....................................................................................SMRLKLLRKKLGVTLETLAEKTGLTKSYLSKVERGLNTPSAAALKLAKALNVQVEELFS 61
11 -12.500[S] COG4197 Uncharacterized protein conserved in bacteria, prophage-related  ali follow..  16  7..........................................................................................IKSLRVGDAKKFAARLGVSPSYLSQMASGRTAISPTRALMIE........... 48
12 -11.400[S] COG5484 Uncharacterized conserved protein  ali follow..  14  1..........................................................................................MVDKHGMKYKDLAEKYGVSVNTIKSWKQ......................... 37
13 -10.400[S] COG5606 Uncharacterized conserved small protein  ali follow..  20  32......................................................................................IINNWIEQQGFSQAQAASALGVTQPRISELARGKIQ---SIDKLITMMAHAGLHI.. 85
14 -9.310[L] COG4220 Phage DNA packaging protein, Nu1 subunit of terminase  ali follow..  24  1..............................................................................................MNVNKKKLAEIFGCDVRTVTAWSQG........................ 26
15 -9.240[K] COG2932 Predicted transcriptional regulator  ali follow..  10  7....................................................................................TDRLFEIAKEQGLKPADIAERLNISQQALKNWESRGIAAK-ALPEVAKAFGVSETWLRT 65
16 -9.070[R] COG3093 Plasmid maintenance system antidote protein  ali follow..  15  17........................................................................................VEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPE.... 67

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.