current user: public

If you have questions about the server, please let us know.

Query: [O] COG3175 Cytochrome oxidase assembly factor, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MTQTPASPDPTDDARAAERGLNRAMLGKLAVVVVMMFGFGYAMVPLYKKICELTNINVLTTRDLDGGALRNTQVDQARTVTVEFDSNSQGPFRFRPVKNSMEVHPGEINQIVYEVVNKEGRSVSAQAIPSYAPKQATEFFKKIECFCFKQQTLAGNESREMPVVFVIDPDLPKDVKTITLSYTFFEIGKPVAQTPTVPGKGTLast
1 -106.000[O] COG3175 Cytochrome oxidase assembly factor  ali  100  1MTQTPASPDPTDDARAAERGLNRAMLGKLAVVVVMMFGFGYAMVPLYKKICELTNINVLTTRDLDGGALRNTQVDQARTVTVEFDSNSQGPFRFRPVKNSMEVHPGEINQIVYEVVNKEGRSVSAQAIPSYAPKQATEFFKKIECFCFKQQTLAGNESREMPVVFVIDPDLPKDVKTITLSYTFFEIGKPVAQTPTVPGKGT 202
2 -79.300[O] KOG2540 Cytochrome oxidase assembly factor COX11  ali follow..  29  268.QQFWRMKSTDSPEDAARKLRAKSTLYYITAGGVLIVGLSYAAVPLYSIFCQAYSYGGTTTQGHDAEKVEHMKKIEDRVLKIRFDIGSSMRWNFKPQQYEIKVAPGETALAFYTARNPTDKPVIGISTYNVIPFEAGAYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPEITADCDTITLSYTFFEAKEGLKLNFPSYAKPH 475
3 -9.360[U] KOG1631 Translocon-associated complex TRAP, alpha subunit  ali follow..  2.......................RHLMFLMLMVLPIVICTFSAPNKFGAYAAEAVEDDLVDVEGEEGAVTGEDAEADEDSDTGSSSSPNADTYLLTPGQQLDLPGGKPVEFLIGFTNKGAEEFVIETVEA-YPMDFNYFIQNFSAVAY-NREVKPGFESTVSYTFLPSDQFAGRPFGLNIALAYRDANGI............ 175
4 -8.780[U] KOG3317 Translocon-associated complex TRAP, beta subunit  ali follow..  5...................HRESGCLLRLLLSCTEILDKEIPKLQMFKHLLTLFALCAVFSTCLSEDETRA-------RLLVSKQILNK------------YLVEKSDLLVRYTIFNVGSGAATKVRLVDSGFHPEA--FDVVG---AVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETLQLAVSSE.... 163
5 -8.430[P] COG4454 Uncharacterized copper-binding protein  ali follow..  14  1...................................MTRLKLALLLTALATPAFAGGTHSGGDNVMAIGEPGDKSKVTQTIQVTMKETPDGKMMFTP--AKFEFKKGKT--VRFAVKNVGELDILDEQKANLEHKAVMAKAPEMEHDNPNAISLAPGESGEI......................................... 125
6 -8.250[E] COG0832 Urea amidohydrolase (urease) beta subunit  ali follow..  12  2.........................................................................................IPGEIIAAAGEIELNAGLE-TVSIEVANSGDRPVQVGSHYHFAETNPGLIFDRDAARGKTAVRFEPGQTRQVTLIPLSGKREVFGFRQQV....................... 97
7 -7.950[S] COG4719 Uncharacterized protein conserved in bacteria  ali follow..  13  1..........................................MFP-THLTLTALALTSVSFAAQAAPAATSPIKLSGATYSVAQVTENGKTTERLVDASGKGALPGSLLQMTQKVQNVSARSVNGLRLNMRVDPATI................................................................. 100
8 -7.330[S] COG1470 Predicted membrane protein  ali follow..  580..........................................................................GIKKEIPVKIKLIGSYNMNVNLLNYRLTITAGEEKTAMMDIFNFGNAPLTNLKITVKGPQGWDVKVDPSQI-----PSLSPKGRERVTITVKVPEGTPAGDYRVQITVKADQAEWQDTLRVVVRQRST 702
9 -6.730[T] KOG3900 Transforming growth factor beta, bone morphogenetic protein and related proteins  ali follow..  11  280..........................................................EKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKA------C-C------VPTELSAISMLYLDENEVLKNYQDMVVE..................... 391
10 -6.530[M] COG1361 S-layer domain  ali follow..  13  709..............................................FKVDVDENAKSGRYLIPLTIEYKDPTGKFRQIEVNIPVIIAEKPKLVITDVRFGEKPVQGKDVNIYITVKNVGGEQAESVVI-PFTLVKRTDYIGT----------LNPNQTGEGVITLSIEKDAVPKVYNILIRMRAVGDKEKGDDNVYVFEG.. 859

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.