current user: public

If you have questions about the server, please let us know.

Query: [I] COG3239 Fatty acid desaturase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst MSTVEMDQAAPESAAHHPLPDPGESVPRLALPTIGIFLATLTAFVGSTTAYISGWIPFWVTIPVNAAVTFVMFTVVHDASHYAISSIRWVNGLFGRLAWLFVGPVVAFPAFGYIHIQHHRHSNDDEQDPDTFASHGSLWVLPLRWSMVEYFYIKYYLPRGRSRPVIEVAETLVMMTLFLTGLIVAIVTGNFWTLAIVFLIPQRIGLTVLAWWFDWLPHHGLEDTQRSNRYRATRNRVGAEWLFTPVLLSQNYHLVHHLHPSVPFYRYLRTWRRNEEAYLERNAAISTVFGQQLNPDEYRQWKELNGRLARLLLast
1 -115.000[I] COG3239 Fatty acid desaturase  ali  100  1MSTVEMDQAAPESAAHHPLPDPGESVPRLALPTIGIFLATLTAFVGSTTAYISGWIPFWVTIPVNAAVTFVMFTVVHDASHYAISSIRWVNGLFGRLAWLFVGPVVAFPAFGYIHIQHHRHSNDDEQDPDTFASHGSLWVLPLRWSMVEYFYIKYYLPRGRSRPVIEVAETLVMMTLFLTGLIVAIVTGNFWTLAIVFLIPQRIGLTVLAWWFDWLPHHGLEDTQRSNRYRATRNRVGAEWLFTPVLLSQNYHLVHHLHPSVPFYRYLRTWRRNEEAYLERNAAISTVFGQQLNPDEYRQWKELNGRLARLL 312
2 -79.500[I] KOG2987 Fatty acid desaturase  ali follow..  14  16.EEPHASRRKIILEKYPQIKKLFGHDPNFKW--VAGAMVLTQILALFVVKDLSWSWLIVAAYCFGGIINHSLMLAVHEISHNLAFGHSMHNRILGFICNLPIG-LPMSISFKKYHLEHHRYQGDEAIDTDIPTLLEALFDTTFGKFLWVCLQPFFYIFRPLIINPKPPTRLEIINTVVQLTFNALIVYFLGWKPLAYLLIGSILAMGLHPVAGHFISEH--------YMFAKGFETYSYYGPLNWITFNVGYHNEHHDFPAVPGSRLPEVKRIAKEFYDTMPQH--TSWTRVLYDFIMDPAVGPYARVKR.. 314
3 -62.800[I] KOG4232 Delta 6-fatty acid desaturase/delta-8 sphingolipid desaturase  ali follow..  13  104.KNKELTDEFRELRATVERMGLMKANHVFFLLYLLHILLLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKG-APASWWNHMHFQHHAKPNCFRKDPDIYMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVIQRKKWVDLAWMITFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHNMDWVSTQLQATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLSAFADIIHSLKESGQLWLDA. 440
4 -26.200[I] COG1398 Fatty-acid desaturase  ali follow..  12  25.KRQLFRFFVRFFFMTAALPNDSKPKLTPAWTVIFFFTSILVALLAFLPQFFSWKAVGMAFLLYVITGGIGITLGFHRCSHRSFNVPKWLEYIFVICGTLAC----GVFEWVGLHRMHHKFS-DTTPDP--HDSNKGFWWSHIGWMMFEIPAKADIPRYTKDIQDDKFYQFCQNNLILIQVALGLILFALGGWPFVIWIFVRLVFVFHFTWFVNSATHK--------YVSHESNDYSRNCWWVALLTFGEGWHNNHHAYQGLQWWEVDLTWMTIK..................................... 295
5 -24.400[I] KOG1600 Fatty acid desaturase  ali follow..  10ISKQFLAADLNEIRQMQEESKKQVIKMEIVWKNVALFVAIGALVGLYQLVFQAKWATVGWVFLLHTLGSMGVTGGAHRLAHRAYKATLSWRVFLMLINS--IAFQNDIIDWARDHRCHHKWT-DTDADP--HSTNRGMFFAHMGWLLVKKHDQLKIQGGKLDLSDLYEDPVLMFQRKNYLPLVGIFCFASAFIAFYTAALFRYCFTLHATWCINSVSHW--------WQPYDHQASSVDNLWTSIAAVGEGGHNYHHTFPSEHAEFLNWTRVLID..................................... 293
6 -17.600[O] KOG3011 Ubiquitin-conjugating enzyme  ali follow..  11  40.EMKLVVEQRLVNPPLSNDPTLQSTWTHRLWVAAGCTTVFVSFSKSIIGAFGSHLWLEPSLAGFAGYILADLGSVYH-TDNYGDESTPLVGIHI------------------EDSQDHHKCPWTITK---------------------------------------RQFANNLHFMARGTTLIVLPLDLAFDDHVVHGFVSMFAFCVLFCQLFHAWAHGTKSKLPPLVVGLQDIG----------LLVSRIHHMNHHRAPYNNNYCVKAMEMVLY..................................... 263
7 -16.800[I] KOG0873 C-4 sterol methyl oxidase  ali follow..  16  86..KLQPTKIPSAKEQLYCLKSVLLSHFLVEAIPIWTFHPMCEKLGITVEVPFPSLKTMALEIGLFFVLEDTWHYWAHRLFHYGVF-------------------------YKYIHKQHHRYAA--------------------------------------SAEYAHPAETLSLGFGTVGMPILYVMYTGKLHLFTLCVW------ITLRLFQAVDSHSGYDFPWSLNKIMP-------------FWAGAEHHDLHHHY..................................................... 264
8 -16.100[I] KOG0874 Sphingolipid hydroxylase  ali follow..  11  153.....................................................MYGMSALKIFAGFLFVDTWQYFLHRLMH----MNKTL--------------------YKWFHSVHHELYVPYAYGALFNNPVEG------------------------------------FLLDTLGTGIAMTLTHLTHREQIILFT--------FATMKTVDDHCGYA--------------LPLDPFQWLFPNNAVYHDIHHQQFGI--TNFAQPFFTFWDNLFQTNFKGFEEYQKKQRRVTIDKYKEFLQEREL.. 326
9 -15.700[I] KOG0872 Sterol C5 desaturase  ali follow..  12  90............................LTVALFLLEIRGYSKLHDDLGEFPYGLFELVVSIISFLFFTDMFIYWIHRGLHHRLV-------------------------YKRLHKPHHIWKI----------------------------------------------TPFASHAFHPIDGFLQSLPYHIYPFIFPLHKVVYLSLYILVNIWTISIHDGDF-------------------ILQPFINGSAHHTDHHMF..................................................... 235
10 -14.600[I] COG3000 Sterol desaturase  ali follow..  11  45................................ALLAGITWNKWMMGHSLLHTSDALPPLLAGFAAYFVNTFVTYWWHRARHANDT------------------------LWRLFHQLHHA--------------------------------------------PQRIEVFTSFYKHPTEMVFNSLLGSFVAYVVMGISIEAGAYYIMFAALGEMFYH----------------SNLRTPHVLGYLFQRPEMHRIHH....................................................... 185
11 -13.700[I] KOG0539 Sphingolipid fatty acid hydroxylase  ali follow..  11  94............................SYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRLFHMKPPSDS-----------------YLIMLHFVMHGQHHKAPFDGSR---------------------------------------------LVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHY--------------YLHFGSPHKGSYLYSLKAHHVKHH....................................................... 248

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.