current user: public

If you have questions about the server, please let us know.

Query: [P] COG3420 Nitrous oxidase accessory protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460
# Score Template Links and tools%idFirst MVLPRLFRTAGIMSLLAAALCAGAQARQIDVAVGESVQAAIEKAEPGDVVRLRAGRHEGAVVIDRAIELTGEPGAVLDGLGTGNAITVNAPNAIVRGLEVHGSGDNLPDLHSGIFVSRTATGARVENNRLIGNTYGIYLHGAADSIAIGNEVLGRRGVRMAETGSGVSVWNAPGAQVVGNTIRYGRDGIYTNASRKNIFRDNVMEDVRFAVHYMYTDDSAVIGNVSRNNSVGFAIMYTNRLKILNNVSEGDRDHGLLLNYANSSIITGNRVVGRMQPIERWLEAGLQKGEHGVPGEEKVEASAGETARLGPEKCVFIYNANKNKFSENSFENCSIGIHFTAGSEGNAMSGNSFINNRNQVKYVGTRNLDWSVDGRGNYWSDNPAFDLDGDGIADSPYRPNDLIDRVLWTVPQAKILINSPAVDTIRWAQTQFPALLPGGVVDSHPLMKPLLKPTAQLKESKHNDLast
1 -135.000[P] COG3420 Nitrous oxidase accessory protein  ali  100  1MVLPRLFRTAGIMSLLAAALCAGAQARQIDVAVGESVQAAIEKAEPGDVVRLRAGRHEGAVVIDRAIELTGEPGAVLDGLGTGNAITVNAPNAIVRGLEVHGSGDNLPDLHSGIFVSRTATGARVENNRLIGNTYGIYLHGAADSIAIGNEVLGRRGVRMAETGSGVSVWNAPGAQVVGNTIRYGRDGIYTNASRKNIFRDNVMEDVRFAVHYMYTDDSAVIGNVSRNNSVGFAIMYTNRLKILNNVSEGDRDHGLLLNYANSSIITGNRVVGRMQPIERWLEAGLQKGEHGVPGEEKVEASAGETARLGPEKCVFIYNANKNKFSENSFENCSIGIHFTAGSEGNAMSGNSFINNRNQVKYVGTRNLDWSVDGRGNYWSDNPAFDLDGDGIADSPYRPNDLIDRVLWTVPQAKILINSPAVDTIRWAQTQFPALLPGGVVDSHPLMKPLLKPTAQLKESKHND 464
2 -19.000[R] KOG1777 Putative Zn-finger protein  ali follow..  14  529......................................RIYANAYAGIWITSHSDPTIRKNEIFTGVYIFGEGRGLIEGNALAGIQIRSQSDPIVRLNKIHDGLHG------GIYVHEKGRGLIEENEVYGNTLAGIWVTTGSSPILRKNRIHSGK-------QVGVYFYDQGHGLLEENDIFNHLSGVQIRTGSNPKITRNKIWGGQGGVLVYNGGKGCLEDNEIFDNAAGVWIKTDSEPTLRRNKIYDGRDGGVCIFNRGKGLLEDNEIFRNA--------------QAGVLISTESNPTLRRNRVFDGSAGIEITNGATATLEENQLFRNKYGGLCVATGVTPVQRGNRIYDNHDTISRAIKTG................................................................................................. 843
3 -13.300[G] COG4677 Pectin methylesterase  ali follow..  12  92...............................VTHTTIQAAVDAAIIKRYIAVMPGEYQGTVYVPAAITLYGTGEKPIDGVLCSAVFWSQNNGLQLQNLTIENTDSVDAGNHPAVALRTDGDQVQINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVIVSGRGAVVFDNTEFRVVNSR---TQQEAYVFAPATLSNIYYGFLAVNSR....................................................................................................................................................................................................................................................... 332
4 -12.500[R] COG3291 FOG: PKD repeat  ali follow..  12  1..MKSKTLFIVFTLIFLIGVPSTVSARDII-GSYSTIQEALDGAEAGDVIIIKPGTYVENINVSKAIKPETNNVFIEPADSTKATIILSNVGITLTGFDIDGSVYV-NNAMLGNSEYYLNNMSQITNNVIENGGIGVGSESSGIIISGNKITGGTGIDVAC---------CGDYNEITDNDILNCSTGIYVYDERYVPPISGNKINNCDVGIHVSGLYYDLENNEITNCGVGVIAGETGGASLIGNKIMYCSDCGLKVLGSLETKGAYNNYFNNTVNVKFGDYEDTYTWNTSLTEGSQTAVDANGDGIADSAYAISEKNYDYLPLTAKYNSASPASDFTANVTSGTAPLVVLFTDTGSGVTPTS-------------LWD--------GDGITSKHFTNPGTYD............................................................ 409
5 -10.700[M] COG5434 Endopolygalacturonase  ali follow..  15  1MILSHRYTLIALAAAILSSGAHAAGASVTSQPDASRIQTAIDNCPAGQAVRLGESGFSGSLKLKSGVTLWIDTGVTLFASRNPAIVARDTVGSGIVG-IIDGRGGGLNQQNPRLVQLYNGSAFTLYRVTVQNSNFHIVTTGTAGVTAWGIKIVTPSTPETVKNTDGFDPGQSTNVVLANSYISTGDDHVAIKASTRNLLFAHNHFYYGHGLSIGSETDGGVSNMQVTDLAMGNDSSGGNGLRIKSDISRGGKVNNIVYNGICMRNVKEPLVFD............................................................................................................................................................................................... 398
6 -9.910[G] COG3866 Pectate lyase  ali follow..  14  192.....................TNAKGTKTTCTGLVNILAGRQKGYDKSPLIIRIGEIKASDITHTYIQLKGCYNVTFEGVGKDATAY-DARNLELRNVGIMMFGDD------AISLDTDNQNIWVHNNDLFYG--------------------AAGHDADQVKGDGS---DSTFVSVSYNHFHDSGKSSLCGMQDTQ------------------NYYVTYHHNWFDHSDSRHPRIRVGSVHVYNNYFDGNAKYGVGVTKGASAFVEANYFRD............................................................................................................................................................................................... 412
7 -8.350[R] KOG0231 Junctional membrane complex protein Junctophilin and related MORN repeat proteins  ali follow..  11  5..............................................GRFNFDDGGSYCGGWEDGKA---HGHG-----------VCTGPKGQGEYTG--------SWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFK------GRYGVRECAGNGAKYEGTWSNGLQDG-TETYSDGGTYQGQWVGGMRQGYGVRQSRSPLRTSINSLRSEHTNGTPLHPDASPAVDGSPAVSRGGFVLVAHSDSEILKSKKKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTET-YVGEWKNDKRSGF--GVSQRSDGLKYEGEWASNRR------HGYGCMTFPDGTKEE............................................................ 335
8 -8.010[S] COG4939 Major membrane immunogen, membrane-anchored lipoprotein  ali follow..  1MKLKKVAMGITVVMASSLLLVGCGSSDDSSKDKKSTDTKQTETKKTAKT--MTDGTYKLE-------------EKNFDDKGWKGFMSIEVKDGKITKANYDYKNKDLKSEDADYEKAMKDKVGTGPQEYLKQLSDSLVKGQSASSVVSGATHSSDA.................................................................................................................................................................................................................................................................................................................... 148
9 -7.410[S] COG1934 Uncharacterized protein conserved in bacteria  ali follow..  13  1MKSKNKISHLLLACSLLAASLSAFALTGDTEQPAEVKSDKQTLDMETNTV-----TFIDNVVIKQTIEIKADKVVVTRPGGDQSKMIIEGFGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAY----------EQLDSNIKGDRIT....................................................................................................................................................................................................................................................................................................................... 140
10 -6.990[NO] COG1261 Flagellar basal body P-ring biosynthesis protein  ali follow..  1MAVKRKNIIIVALGLLLSHHILAQQTLAAHQALETDLSVQVNQCDAPEITLPANARPWGNISLS-QTQVQVSGRYAVAVRRLAAGEKISAQDIQMKQGRLDTLPPGALLDAHFA-QGAVSQRQINAGQPL-----------TRNMLRRLWLVKAGQDVPVLAQGDGFNV------NSNGKAMNNGAAQIRVRMPSGQIVSGTVADDGTIRIML........................................................................................................................................................................................................................................................... 232

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.