current user: public

If you have questions about the server, please let us know.

Query: [R] COG3607 Predicted lactoylglutathione lyase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MRMIFVNLPVKNIEVSKSFFTALGFSFNPEYSDDRTLCMIVEENIFVMLLQEDRFRDFINGDIADAKQSTEVLTCLSAGSREEIDEMIATALASGGSSWKPVQDHGFMYAGSFQDPDGHVWELVHMTGQGLast
1 -83.500[R] COG3607 Predicted lactoylglutathione lyase  ali  100  1MRMIFVNLPVKNIEVSKSFFTALGFSFNPEYSDDRTLCMIVEENIFVMLLQEDRFRDFINGDIADAKQSTEVLTCLSAGSREEIDEMIATALASGGSSWKPVQDHGFMYAGSFQDPDGHVWELVHMTGQG 130
2 -38.400[R] COG3565 Predicted dioxygenase of extradiol dioxygenase family  ali follow..  3LMPFHLAIPVHDLPAARRFYGEFGLSEGRSAEHWVDFDF--GHQLVIHQHPQTDSQRHAGSNPVDGHDVPVPHFGVVL-AWDDWHALAERLQQRGTRFVIEPYIRFKGATLFLFDPCGNALEFKSFRDMG 136
3 -31.500[G] KOG2944 Glyoxalase  ali follow..  15  10YKLNHTMIRVKDLDKSLKFYTEFGMKLIDQWVFEEHGVERSKREGILELTYNFGTEKKEGPVYINGNTEPKRGFGHICFTVDNIESACAYLESKGVSFKKKLSDGKMKHIAFALDPDNYWIELV...... 151
4 -27.300[R] COG2514 Predicted ring-cleavage extradiol dioxygenase  ali follow..  17  168TIIGHIHLHVSDLKEAKAFYTDLGFDIVGNYAGMSALFVSAGGYHHHIGLNI---WAGRNAPPKPTNASGLDYYTVVLPHQEELDLVANRVKHAGYSIEETEN------SFRVKDPVSGAYITFV..... 284
5 -27.000[E] COG0346 Lactoylglutathione lyase and related lyases  ali follow..  157YGLGPVFLTVVSLKNMEAILQTFGFRKVTEEDGLHLYEVGEGGNGAQVI-----VEERTDIPAAMQGYGGVHHVAFRVDDHEELQKWIDRMNTIEAPNSG-YVNRFYFESLYVPVSERILFEFATDGPG. 280
6 -20.500[R] COG3324 Predicted enzyme related to lactoylglutathione lyase  ali follow..  16  142....WHQLTTRDYRSVIDFYRQVGWRTEQISDTD-------EFCYTTAWFDDQQLLGVMDGSSCLPEGVPSNWTIF---GAEDVDETLRVICDNGGSVVRAAENTPYGRLAAAADPMGVVFNLS...... 253
7 -16.300[S] COG2764 Uncharacterized protein conserved in bacteria  ali follow..  11  1MQIVPYLIFNGNCREAFSCYHQHCGDIPADWKDKIMHARLVVGSFALMASDNH--------PAYPYEGIKGCSISLNVDSKAEAERLFNALAEGGSVQMPLGPTFWAASFGMFTDRFGVAWMVNCEQDR. 137
8 -14.300[S] COG3865 Uncharacterized protein conserved in bacteria  ali follow..  14  1MQKITTFLWFDQAEEAMNHYMSIFKNSKELSVTRWPKGHADEGKVLVASFELDGVPFLALNGGPQYKFTEAISLSIDCKTQEEVDHFWTRLTEDGGEPGP----------GWLKDKFGVSWQV....... 115
9 -12.100[ER] COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins  ali follow..  16  22AGFAFVEFVCPEPEELVALFGKLGFKAQGQHAQTGAVLLRQNEAALIVNPAPNPFRDVHGASARA--------IAIHV---DDAANALAQALAGGARRATPAECGAFVVDAPAIVGIGDSLVYF...... 134
10 -9.320[E] KOG0638 4-hydroxyphenylpyruvate dioxygenase  ali follow..  12  17LSFDHLTFYVGNAKQAASYYTRLGFEPLGYQGLETAKHAVRQNKIVFVFVSAYTPDDEEHGLHLMRHGDGVKDVAFEV---EDLNAIFTLAVSRGAEVVRDIWE.......................... 123

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.