current user: public

If you have questions about the server, please let us know.

Query: [G] COG3866 Pectate lyase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560
# Score Template Links and tools%idFirst MGRRFSKRLLVAILASSMAISATFSANASTKYGKNYVSSVTKAVETSAVSILESEGSLESANVEWSPVQGAASYNVYYKAADALDSSYTKIDDELIRQYPSSFRADVLGLAAGNYVLKIVPVVNGVDAINEEATTQALTVKANKREGFAFSPASPMKTSSGGYNDDGTVASNAEILYITASNVNTVTENVVTNAKGTKTTCTGLVNILAGRQKGYDKSPLIIRMIGEIKASDITGLNEHTYIQLKGCYNVTFEGVGKDATAYGWGFLIRDARNLELRNVGIMMFGDDAISLDTDNQNIWVHNNDLFYGAAGHDADQVKGDGSCDIKQDSTFVSVSYNHFHDSGKSSLCGMQDTQNYYVTYHHNWFDHSDSRHPRIRVGSVHVYNNYFDGNAKYGVGVTKGASAFVEANYFRDCKYPMLSSLQGTDIFYDSKGDFSGEDGGMIKAYNNKIEGATRLVYANQDPIQFDAYLASSRNEVVPSTYKTLVGGTTYNNFDTSSVMYKYQPDSPDDVKESVTSYAGRVDGGDLIFNFTDADDTSSVINPDLMAKVKNYSSTLVSDGSKVVKLast
1 -160.000[G] COG3866 Pectate lyase  ali  100  1MGRRFSKRLLVAILASSMAISATFSANASTKYGKNYVSSVTKAVETSAVSILESEGSLESANVEWSPVQGAASYNVYYKAADALDSSYTKIDDELIRQYPSSFRADVLGLAAGNYVLKIVPVVNGVDAINEEATTQALTVKANKREGFAFSPASPMKTSSGGYNDDGTVASNAEILYITASNVNTVTENVVTNAKGTKTTCTGLVNILAGRQKGYDKSPLIIRMIGEIKASDITGLNEHTYIQLKGCYNVTFEGVGKDATAYGWGFLIRDARNLELRNVGIMMFGDDAISLDTDNQNIWVHNNDLFYGAAGHDADQVKGDGSCDIKQDSTFVSVSYNHFHDSGKSSLCGMQDTQNYYVTYHHNWFDHSDSRHPRIRVGSVHVYNNYFDGNAKYGVGVTKGASAFVEANYFRDCKYPMLSSLQGTDIFYDSKGDFSGEDGGMIKAYNNKIEGATRLVYANQDPIQFDAYLASSRNEVVPSTYKTLVGGTTYNNFDTSSVMYKYQPDSPDDVKESVTSYAGRVDGGDLIFNFTDADDTSSVINPDLMAKVKNYSSTLVSDGSKVVK 564
2 -9.910[P] COG3420 Nitrous oxidase accessory protein  ali follow..  14  22...............................................................................................................................................................................................AGAQARQIDVAVGESVQAAIEKAEPGDVVRLR-AGRHEGAVVI----DRAIELTGEPGAVLDGLGTGNAIT-------NAPNAIVRGLEVHGSGDNGIFVSRTATGARVENNRLIGNGRRGVRMAETGSGV-----NAPGAQVVGNTIRYGRDGIYTNASRKNTDDSAVIGNVSRNNSVGFAIMYTNRLKILNNVSEGDRDHGLLLNYANSSIITGNRVVG........................................................................................................................................................ 273
3 -9.020[M] COG5434 Endopolygalacturonase  ali follow..  15  65.................................................................................................................................................................DGNPSNSQPDASRIQTAIDNCPAGQAVRLVKGSAGESGFLSGS--------KLKSGVTLWIDTGVTLFASRNPAKSCNALIVARDTVGSGIVGDG---IIDGRGVQLYNGSAFTLYRVTVQNSNTDGFDPG-QSTNVVLANSYISTG-----------DDHVAIKASTRNLLFAHNHFYYGHGLSIGSETDGGVSNMQVTDLAMDGNDSKSDISRGGKVNVYNGICMR--------NVKEPLVFDPFY........................................................................................................................................................... 401
4 -6.050[TU] KOG3895 Synaptic vesicle protein Synapsin  ali follow..  702.AGPPPPPPTNVTAVGSNANSSSGYRNSFSSSLSKDKTSYGNYGSTTSVETITRMDTNTTNIGATATEAGEASGVTAITNISNSDGIVAPTTGTITTSVTTNDWRSAIGMRSASVYSAPAAVTTVLPGDTSGYDSNSIASQGEGLNNPSDLPSYTRPSYSRSESNASKHSDLDVIFGDSKTTPASYGNGKYTRAAGSISDA-------DMIFGGPPSNYKTDRFGASKSMSMTSGGVGSGNGSGSGLGGYKIYDSIQNAAFSDFSDS-MSSIGSHTKRWSASKEEDDELDLK................................................................................................................................................................................................................................................................................ 986
5 -5.870[S] COG5654 Uncharacterized conserved protein  ali follow..  38.............................................................................................................................................................SGAGAARFGGRWNPIGPAIYAARELSTAWAEYNQGFVQHPALIVQLELRGARLADLTDASVLLELGVDEAIHRCEWRDALDKGAVPETHRLQSELLARDYHGVIY--SFMSPGGTCVALPRLDVIDPDGR-------SPASWV........................................................................................................................................................................................................................................................................ 184
6 -5.660[A] KOG3428 Small nuclear ribonucleoprotein SMD1 and related snRNPs  ali follow..  12  9....................................................................................................................................................................................................................................................KLTNETVSIELKNGTIVHGTITSVDMQMNTHLKAVKMTVKGREPVPV----ETLSIRGNNI................................................................................................................................................................................................................................................................... 65
7 -5.470[A] KOG3172 Small nuclear ribonucleoprotein Sm D3  ali follow..  14....................................................................................................................................................................................................................................................EASGHIVTVELKSGELYRGSMIECEDNWNCQLEDITYTAKDGKVSQL----EHVFIRGSKV................................................................................................................................................................................................................................................................... 70
8 -5.440[M] COG3061 Cell envelope opacity-associated protein A  ali follow..  12  164..................................................................................................................................................................................................................................................SYQVQTGKTLAQL-----FRDNNLPVNDVFAMALSNLK-----GQEVKIMLDAQG--VTALAIETPENTEVLFSRQNDGSYRREH............................................................................................................................................................................................................................................. 246
9 -5.190[G] KOG2692 Sialyltransferase  ali follow..  11  216.........................................................................................................................................................................................................................................................KTCAIVSSAGSLAGSGRFI-DTHDIVMRNHATQGHEVD---VGSKTTIRVVNSQVVTKPEFDFTRAPIFRNVTI--SSGFIGLALLLPH----PQVDFVEYVPSTRLNGRCH--YYSKEMNS--ACTFGSWHPLALMALDMNMAEMSVFQFGILRIRRNFF.......................................................................................................................................................... 449
10 -5.030[A] KOG3448 Predicted snRNP core protein  ali follow..  9....................................................................................................................................................................................................................................................SLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYP---MLSVKNCFIRGSVV................................................................................................................................................................................................................................................................... 67

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.