current user: public

If you have questions about the server, please let us know.

Query: [R] COG3897 Predicted methyltransferase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MRTDPERFILDNAAIMHPPHVPELRLHLATEAHELWLKTEEELEEIGLPPPFWAFAWAGGQGLARYILDHPESVCGKRVLDFASGSGLVAIAAAKAGAAKVLAADIDPWTETAIRLNAALNGVDIGFTGLDLVGKPVDADVLLAGDVFYDRAFADLLVPWFVELTEKGMIVLVGDPGRAYLPKERLRAEATYQVPVTRALEDSDVKKTTVWRFILast
1 -78.500[R] COG3897 Predicted methyltransferase  ali  100  1MRTDPERFILDNAAIMHPPHVPELRLHLATEAHELWLKTEEELEEIGLPPPFWAFAWAGGQGLARYILDHPESVCGKRVLDFASGSGLVAIAAAKAGAAKVLAADIDPWTETAIRLNAALNGVDIGFTGLDLVGKPVDADVLLAGDVFYDRAFADLLVPWFVELTEKGMIVLVGDPGRAYLPKERLRAEATYQVPVTRALEDSDVKKTTVWRFI 214
2 -40.400[J] COG2264 Ribosomal protein L11 methylase  ali follow..  23  89.QIEDKDWEREWMDNFHP-----MRFGKRLWICPSWREVPDENATNVMLDPGLAFGTGTHPTTALCLEWLDSLDQDKTVIDFGCGSGILAIAALKLGAKSAVGIDIDPQAILASRNNAEQNGVADRLQLFL--------SEDKPADLKADVVVANILAGPLKELYPVIRQLV--KPNGVLGLSGILATQASSVCDAYAQFVLEPVEEREEWCRI 288
3 -32.500[A] KOG2793 Putative N2,N2-dimethylguanosine tRNA methyltransferase  ali follow..  19  31.....................................................TSVWPCSLILSKFAERWSTLFRRRRGIELGTGCGVAGMAFYLLGLTEIVLTDIAP-VMPALKHNLKRNKTSLKTSIVYWNNRKPPFDLVIAADVVYIEESVGQLVTAMELLVADDGAVLLGYQIRSPEADKLFWELCD-KVPHEHLHSDYAYEETDVYIF. 221
4 -31.700[R] KOG2497 Predicted methyltransferase  ali follow..  26  151.......................................................IWPSSLFLSEFVLSFPELFANKACFEVGSGVGMVGICLAHVKAKEVILTDGDLLTLSNMKLNLERNHLRVKCTHLPWETASERPDIVLGADVIYDPSCLPHLLRVLVALLKNPPK............................................ 287
5 -31.000[R] KOG2920 Predicted methyltransferase  ali follow..  25  168.......................................................IWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDVTLPNVVANLYKCRFFSGEWSELFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLA........................................ 322
6 -28.000[J] COG2263 Predicted RNA methylase  ali follow..  15  25.....................................................QYQTPSPLAAEILHFAYMQGDLDESVQDLGCGTGILAIGAKLLGARKVVGYDTDPKALEVARKNAERLGVEVEFVCSDIKKVSGHVKTTL-MNPPFGARVKGRDRPFLSSALRTSEVIYSIHNRGSLAFIQKFIKPAVITHSYVAKFKEREIIEVEIYRI. 193
7 -21.100[R] KOG1541 Predicted protein carboxyl methylase  ali follow..  13  32...........................................................QAKMTLRALELLNLQPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSRELEGDLMLQDMGTGIPFRAGSFDAAISISAIQWLCNADTSYNDPKQRLMRFFNTLYA........................................ 146
8 -20.200[H] COG2227 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase  ali follow..  19  4....................VDHAEIAKFEALAHRWWDRESEFKPLHDINP-----------LRVNWIDERAGLAGKKVLDIGCGGGILSEAMAQRGA-SVTGIDMGEAPLAVARLHQLESGVAVDYRQITAEQMPGQFDVVTCLEMLEHVPDPASVIRACHRLVKPGGQVFLSTINRNPKAYLFAVIGAEYIL.................... 169
9 -19.900[R] KOG1271 Methyltransferases  ali follow..  16  42.........................................................AQWRTIDWLLNEEKIDKEASRVLDLGCGNGMFLVGLANEGTGDLTGVDYSPKAVELAQNIAEDNKLSITYKVADLTQPQNELGQF---DVVHDKGTYDAVLDTVEKLLRTADSLFVCNWTEDELVDSFAEKFVKYYTIPTPTFKFGGKVGNVVTSIV 213
10 -19.900[J] KOG3420 Predicted RNA methylase  ali follow..  13  36...............................................................MMEMIDETIGFEGKKLIDIGCGCGMLMTAATMYELETVLGVDIDDEALKICSRNLETAEVQDRC---ELLQADILDPESDLPRGTFDVAVINPVQIGLQMVRPGGSVFSLHKSSTRDYILKNAKKWDGVGAECCAEMR............. 185
11 -19.900[H] KOG1270 Methyltransferases  ali follow..  37........................EVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGA-SVIGIDPVDENIKTAQCHKSFDEYRVCSLEEIVEETAETFDAVVASEVVEHVIDLETFLQCCCQVLKPGGSLFITTINKTQLSYALGIVFSEQIA.................... 212
12 -18.600[R] KOG2899 Predicted methyltransferase  ali follow..  14  94...........................................................HDIRLDVLGTQPDLFRNKQLLDIGCNSGHLSIIARKFEVKSLVGLDIDRGLINDAQKTVSHLKRHATPGQGIPHIQFVHGNYVLEERPQFDVILCLSVTKWIHLQLRPGGKLILEP....................................... 233
13 -18.400[OKT] KOG1499 Protein arginine N-methyltransferase PRMT1 and related enzymes  ali follow..  24  242.............................................................GYRDFVYHNKHIFAGKTVLDVGCGTGILSMFCAKAGAKKVYAVDNSDII-QMAISNAFENGLADQITFIDISLPVGKVDIIISEWMGYALTFESMIDSVLDRFLAPSGIMA.......................................... 359
14 -18.300[R] COG4106 Trans-aconitate methyltransferase  ali follow..  18  18..............................................................PARDLLAQVPLERVLNGYDLGCGPGSTELLTDRYGVNVITGIDSDDDMLEKAADRLP--NTNFGKADLATWKPAQKADLLYANAVFQWVPDHLAVLSQLMDQLESGGVLAVQMPDNLQEPT............................... 137
15 -18.200[J] KOG3191 Predicted N6-DNA-methyltransferase  ali follow..  21  36.........................................................EDTFLLIDAIEKDIKEIRSRDVLEIGCGSGVVSTFVNQAGNVTSVATDLNPHALDVTLETAKLNDIKIDVVRTDLFAGLGKVDVLLFNPPYVPTSTLDRLLPRVPELLSPRGVFYLVALHSNDIPALLKEHSEQMTVSVSME............... 205
16 -17.300[R] COG4123 Predicted O-methyltransferase  ali follow..  19  36...............................................................SVLLSRFPRFPKKGLIVDFCAGNGAVGLFASTRTQAQILSVEIQERLADMAERSVRLNGLEMQVICDDLKNQGSKVDMILCNPPYFKVNLEEICRSAQSILKSNGRLAMVHRPDR.................................... 178
17 -17.200[R] COG1568 Predicted methyltransferases  ali follow..  12  127.....................................................AYVTPETTVARVILMHTRGDLENKEIFVLGDDDLTSVALMLSGLPKRIAVLDIDERLIKFIEKVADELGYDIEIFTFDLRKPLHKFDTFITDPPETIKAIRAFVGRGIATLKGPRCAGYFGITRRESSLDKWREIQRLL...................... 271
18 -17.100[R] COG4076 Predicted RNA methylase  ali follow..  16  30..........................................................................ARGLTYDLGAGSGILSFFASEYAD-RVIAIERDPKIAACAGENLSGLDNVSVVNEDALHYEFSAADTII-CEMLDTALIDEEQVPVLLKFLRNDGTVI.......................................... 128
19 -17.000[IR] KOG1269 SAM-dependent methyltransferases  ali follow..  14  108..........................................................SIARHEHYLAYRMGIKPGSRVLDVGCGVGGPAREITEFTGCNLVGLNNNDYQISRCNNYAVKRNLDQVFVKGDFMHEDNTFDYVYAIEATVHAPSLEGVYGEIFRVLKPGGVFGVYE....................................... 229
20 -16.900[A] KOG1975 mRNA cap methyltransferase  ali follow..  14  153...............................................................IKYMLIDKYTKPGDVVLELGCGKGGDLRKYGAAGISQFIGIDISNASIQEAHKSMRNLDYQVVLITGDCFGCRFPCDIVSTQFCLHTEEKARRALLNVAKSLKIGGHFFGTIPDSEFIRY............................... 291
21 -16.800[J] COG1889 Fibrillarin-like rRNA methylase  ali follow..  10  78..........................................................................EGTHILYLGAASGTTPSISDIVGENLIYSVEFSPRVFREFMEKLVDQGRNVVPILGDARFAHYVKGVDVVYIDVAQPAQAKILADNADYFLKPGGHVMLVIKAMSIDVTAPATETFK---QEINTLKERGFDILETVHL. 220
22 -16.700[L] COG0742 N6-adenine-specific methylase  ali follow..  14  34.........................................................PTTDRVRETLFNLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSLAQKGTPHNIVFV-DPPFRRGLLEETINLLEDWLADETLIYVESEVENGLPT............................... 166
23 -16.200[S] COG1255 Uncharacterized protein conserved in archaea  ali follow..  12  1..............................................................MIEVAEFIAREVKKGKVIEVGIGFYTIAKRLKELGF-DVLAIDINKDAVVNAKNS------GLNAEVDDIFNPNISLY---GAKAIYSIRPTPEMMNYILKISK................................................ 96
24 -16.200[R] COG2521 Predicted archaeal methyltransferase  ali follow..  23  125..........................................................................AWGRVFECCTGLGYTAIEALKKGARHVITVEVDPHVLTLASLNPYSRGLAVDVILGDCYARDSSIDFIIATQRLYSEALYREFYRIL----KRGGGVFVSQSGTKYRGLNPYKGVAE....................... 255
25 -16.000[J] COG2813 16S RNA G1207 methylase RsmC  ali follow..  16  217.....................................................VFSRTGLDIGARFFMQHLPENLEGEIVDLGCGNGVIGLTLLDKNPQKVVFVDESPMAVASSRLNVETNMPECEFMINNALSEPFRFNAVLCNPPFHQNVAWEMFHHARRCLKINGELYIVANRKKIFGNCTTIATNNKFVVLKAVKLGRRR.......... 388
26 -15.700[R] KOG2361 Predicted methyltransferase  ali follow..  11  8...PNHDWADQLKTLQLNVLNKTLKIFFRFFLREEEPERTNTDKYERDAKKYWDIFYKHHGDLDKEWNSYFSVSGKSVILEVGCGAGIFPLIATYPDI-FVYACDFSPRAVELVKAHDEYTETRVCAFACDLTGSPSSVDIVTMIFVLVSPEKMSSVLQNIRKVLKPNGCILFRD....................................... 200
27 -14.900[H] COG2242 Precorrin-6B methylase 2  ali follow..  12  54..........................................................SKREVRLLIISALQLKEESIIWDIGAGTGTIPVELALLCPRRIVAVERDEEVAGLIRRNCERFGVNVTVHEGSLPQLIAHPTHICIEG-----PIKQILQETWAHLAPGGRLVATANNLESLYGISETLSELQVRNVEVVQAGVNRLEKRGLQQIF 212
28 -14.400[I] COG3963 Phospholipid N-methyltransferase  ali follow..  15  31.....................................................GAIVPTSSITAKKMASVINPHSGLPVLELGPGTGVIAILARGIKPESLTAIEYSTDFYNQLLRSYPVNGDAFDLDATLGEHKGQMFDSVISA-LNFPMAARIKLLDELLKRVPHGRPVVQ......................................... 158
29 -14.000[J] COG2890 Methylase of polypeptide chain release factors  ali follow..  18  119.........................................................SPIGELIQNRFEPWLTEEPTRIMDLCTGSGCIAIAANAFPEAEVDAIDISVDALNVAEQNIQDHGLEVFPIRSDLFRPQEQYDLIVTSEFRHEPELGRRILANAPLYLKENGILVC......................................... 264
30 -14.000[R] COG1092 Predicted SAM-dependent methyltransferases  ali follow..  21  218..........................................................GGHKTGFYLDQRDKYVKEKEVLNCFSYTGGFGLYALKGGAKRVINADVSQPALDTAKFNAELNGFDISKKRAVFLNADTRFDVVVMDPPKFAESKAQLINMLAMQILNPGGTLLTYSCSGLMDQVLFQKIIADAALDAGRDVK............. 387
31 -13.700[J] KOG2915 tRNA(1-methyladenosine) methyltransferase, subunit GCD14  ali follow..  18  235...............................................................INMILSMMDINPGDTVLEAGSGSGGMSLFLSKASQGRVISFEVRKDHHDLAKKNYKHWRDNVDFIHKDISGATEDIKSLTFDAVALDMLNPHVTLPVFYPHLKHGGVCAVYVVNTQVIELLDGIRTCELALSCEKISE............. 387
32 -13.600[R] KOG2730 Methylase  ali follow..  22  374..........................................................TPEAIAEHIADRVVRNNVSVVVDAFTGVGGNAIQFALRG-AHVIAIDMDPVRLKCARENARVYGVEIDFICADFFDVAATWQADKKLAPKVDAVFLSPIFDVSLKICPNIAYFLPRNTKVSQLVELATKAKSRMEIEQSA---NSKIKTITVY... 550
33 -13.600[A] KOG3045 Predicted RNA methylase involved in rRNA processing  ali follow..  15  200..............................................................LNRIIKTIKKIPKTAIIGDFGCGEGKL----AQSVPNKVYSMDLVAARSDIIACNIT-----------DTPLQARTLDVAVYCLSLMGTDLNEFFLE-ANRVLKLHGTVYIAEIQSRFQDVREFVRCLN....................... 312
34 -13.500[S] KOG2912 Predicted DNA methylase  ali follow..  11  61..............................................................IHDLLSSTSGQKDKKRILDIGTGASIYPLLGCRMYSYDFVGTEIDKFSFETAKSNILQNNMESQIKIVL-TEGMEEFTFVMCNPPFYEHEANKILTESKKRKGIQWYTCMFGKKSSVPAVVDKLREQNISNYGIYELALGKTKRWIICWSF. 254
35 -13.300[QR] COG0500 SAM-dependent methyltransferases  ali follow..  13  102..............................................................YCDEITERLELNDNSFVVEIASNDGYLLQHFLPKNI-PILGIEPAANVARTAIAKGTLVDFFGSRLALEMIGEGRKADLIIGNNVLAQVPDLNDFVRGMQLLLKPEGLLRWNSRI..................................... 217
36 -13.100[R] COG4798 Predicted methyltransferase  ali follow..  20  102..................................................................ILAMAELKPGDTVVDYIMGGGYFTIISGAVGPQVVYAYQPAEFIRFAARYGESLANSKPLDGPITALDLPDNVDAVITVQNYHDMHLKPFANAEIFKSLKPGGVFLVID....................................... 226
37 -12.900[R] COG2520 Predicted methyltransferase  ali follow..  23  110..........................................................NPRLYWERARVASKVLPGESVLIPFAGVGPFVLPSAGKGA-AVCAIEINPDACACLKENVRLNRLEGQVT...................................................................................... 178
38 -12.800[J] COG2265 SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase  ali follow..  12  179.....................................................GFTQPNAAVCQKMLEWACGAALGGDLLELYCGNGNFTLPLSEK-FERVLATEISKTSVGAAQWNIEANGIGARLKDGGIALTDYAFSTIFV-----DPPRAGIDEETLKLVSQFDNIIYIS--NPETLRANLDTLVETHVVERAALFD............. 343
39 -12.600[L] COG1041 Predicted DNA modification methylase  ali follow..  20  167...........................................................PPRIARAMVNLTK--ATREVLDPFMGTGGMLIEAGLIGL-KVYGLDIREDMVEGAKINLEYYGIR-DATKIEEVFPGKTFEAVA-TDPPYGNSTTLPRNELYKRSLESIHSVLEG........................................ 285
40 -12.600[R] COG4976 Predicted methyltransferase (contains TPR repeat)  ali follow..  15  130............................................................EKLAAVIGRVNGGGRFRHVTDLGCGTGLFGERIRDRA-DFLEGFDLSANMLAKAEAKGVYDRLAPEDSGVFGALEQRRADLVSAADVLMYLGNLEGVFVIADRLLAPGGLFAFSVEDACGADGFVLRPSLRYA..................... 268
41 -12.500[J] COG2519 tRNA(1-methyladenosine) methyltransferase and related methyltransferases  ali follow..  16  82...............................................................AALIVAYAGISPGDFIVEAGVGSGALTLFLANI-EGRVVSYEIREDFAKLAWENIKWAGFDVTIKLKDIYEGIEEENV----HVILDLPQPERVVEHAAKALKPGGFFVAYTP...................................... 195
42 -12.500[J] KOG2539 Mitochondrial/chloroplast ribosome small subunit component  ali follow..  14  178...................................................YSLARLAPNAEITRTLEEFNTIFQPETVLDFGSGAGAGFWAIQNKDVKEITMVDLSDAMMKFSMDGRPFVHNNVNFRRHLIPSLNTTYDVVLAHRVLCEIGSSETRLQLIESLKRTNRFLILIESSQTGAFGGLLEARD........................ 335
43 -12.400[R] KOG3010 Methyltransferase  ali follow..  19  33..........................................................................DHKFAWDVGTGNGQAAIGLVEHY-ENVVATDINEAQLQRAIKHSRISYHHTPTTISDLLGGENSVDLIVAAQAVHFFDLNVFYNVAKRVLRKEGGLIAV......................................... 135
44 -12.400[O] COG2518 Protein-L-isoaspartate carboxylmethyltransferase  ali follow..  15  61..........................................................LPPRVEARVLQELAVRKHEDVLEVGAGSGYMAALLAHR-GRHVTTVDIAPELVAFARDNLAVTNVDVVQGDAGQGWGNSLYDVICVSGS------VPAVPESLLAQLKVGGRLSIFVGSAPVMEAQLITRVSETEFQTRNLFE............. 199
45 -12.300[R] KOG2904 Predicted methyltransferase  ali follow..  15  188..............................................................MVEELVTRDEWFKKDIWADLGTGSGAIAIGIAKV-RGRVIATDLSPVAIAVAGHNVQRYSLEGMIEVRELKDLEGKLVGLVSNPPYIPSDDIPGLQAEVGRHEPK--LALDGGIDGTDSLFHLCHGASRM...................... 323
46 -12.200[R] KOG1227 Putative methyltransferase  ali follow..  19  192..........................................................................QGQTIVDMYASLGYYTLFLVSCEAKQVVAIDWNDEILESLIRSAQVNNVDDRLLVIH-VCPDQTADRVYLG---LLPSCRAHWLAACKALKPEGGIV........................................... 290
47 -12.000[M] COG2230 Cyclopropane fatty acid synthase and related methyltransferases  ali follow..  17  173..........................................................AQLAKKRHIAAKMLVKEGDKVLDIGCGWGGMGLYLARHLKANVTGVTLSEEQHAIANQRARDEGLAAKFELTDYRNINDKFDRLVSVGMFVGVGHFAEYFQHVARLMKPDGVFLL--PGGYIPALSEVLEKAGLYVTDIEILRLHYAETLKAWR.. 352
48 -12.000[R] KOG1331 Predicted methyltransferase  ali follow..  14  1MSISSENVEQEYVHSIYSRLATYQQKEHKPSSPRIWPR------------------------VRQFVDQQS---AGSIILDVGCGEAYTSQKSHVIGF------DTCSEVLSSSKKD------DIDLCLADAINIPDSVDAILNVSVIHHLATTARRRQVLQECLRIGGQMLI......................................... 141
49 -12.000[J] COG1189 Predicted rRNA methylase  ali follow..  19  22........................................DDGTELRLKGEKLRYVSRGGLKLEKALKEFHLEINGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAKIRSDERVVVMEFNFRNAVLADFEQGRPSFTSIDVSF-ISLDLILPPLYEILEKNGEVAALIKPQ..................................... 159
50 -11.700[D] KOG0822 Protein kinase inhibitor  ali follow..  10  360...........................LQAPLQPLSENLDSGVYNTFEQDQIKYDVY--GEAVVGALKDGADGRKTVVIYLLGGGRGPIGTKILKSEREKLYIVEKNPNALKYMNVRTWKRRVTISLPGIAKDRGFEQPDIIV-SELLGSFGDNELSPECLTGFLKPTTISI.......................................... 528
51 -11.500[J] KOG1253 tRNA methyltransferase  ali follow..  25  202..........................................................PKEAAKTAYESARRELKPPRVLEALSASGLRALRYAR-GIGQVVALDNDPASVEACQRNIKFNGLMSTSKVVHMLSHPKDFDVVYGAPSIFDSAVQSVADGGLLMCTATDMAVLCG........................................ 332
52 -11.500[L] KOG2671 Putative RNA methylase  ali follow..  20  203...........................................................DAEMAFLMANQAKATSGKLVYDPFVGTGSILVSAARFGA-MTMGADIDIRVVRDGRGPVWSNPMPVALLRMDNNVPPEIFDAII-CDPPYGVECVHDLLHLAARMLVMKGRLVFFFP...................................... 372
53 -11.500[O] KOG1661 Protein-L-isoaspartate(D-aspartate) O-methyltransferase  ali follow..  13  64..........................................................SAPCIYSEVMEALKLQPGLSFLNLGSGTGLSTMVGLILGPFINHGIELHSDVVEYAKEKLE----SFIKNSDSFDKFEFCEPAFVVGNCLYDRIYCGAGVNYMKILLKVGGILVM......................................... 189
54 -11.500[R] COG2384 Predicted SAM-dependent methyltransferase  ali follow..  2..........................................................NEIKLSKRLKAVANYVNGARLADIGSDHAYLPTYLMQKLIDFAVAGEVVKGPFEIAKNHVSEADLSDRIEVLGAIENTDKIDTIVIAGM--GILISEILEAGKEKLGHVKRLIL--QPNNHEESLRQWLVNHQFVIKKEEILLEAG----KFYEII 157
55 -11.400[R] KOG4300 Predicted methyltransferase  ali follow..  14  303............................................................SDYKMKLFDNLVGKAEK-VLEIGIGTGPNFKYYTDIPNVSVIGIDPNAKMESYARKSATEAGLKVHALGESIPLEDASVDAVVGTLVLCSVTDVTQTLKEIKRILRPGGIYIFIE....................................... 422
56 -10.900[J] COG0030 Dimethyladenosine transferase (rRNA methylation)  ali follow..  15  35...........................................................NPLVAQGIVDKADLKQSDTVLEVGPGTGNLTVRMLEK-ARKVIAVEMDPRMAAEITKRVQGTP-KLQVVLGDVIKTDLPYFDVCVSNTPYQIS-SPLVFKLLQQFQREFALRLVARPGDPLYCRLSANVQMWAHVKHIMKVGKNNF......... 190
57 -10.800[A] KOG0820 Ribosomal RNA adenine dimethylase  ali follow..  13  41...........................................................NPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEK-AKKVVACELDPRLVAELHKRVQGTPVKLQVLVGDVLKTDLPFFDTCVANLPYQIS-SPFVFKLLLHFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNF......... 196
58 -10.800[H] KOG1540 Ubiquinone biosynthesis methyltransferase COQ5  ali follow..  14  93........................................................WKDHFINKLDAGKRPNSTTPLNFIDVAGGSGDIAFGLLDHAESTMDIVDINPDMLKEGEKRAMEQGKYFKDPRVRFLVDSDSKDIYTVSFGIRNFTDIQKGLNTAYRVLKPGGIFYCLE....................................... 227
59 -10.700[V] COG3510 Cephalosporin hydroxylase  ali follow..  14  71..................................................................YQEILSELQPSLVIEFGTRYGGSAVYFANI-PFKVLTVDNSHKALDPRARRSSSTDPAIAEQIQRLKNEYPGKIFAIL-DSDHSMNHVLAEMKLLRPLLSAGDYLVVED....................................... 191
60 -10.600[R] COG3129 Predicted SAM-dependent methyltransferase  ali follow..  12  105.........................................................PPVPGRADYIHHLADLLAEASILDIGVGANIYPLIGVHEYGWRFTGSETSSQALSSAQAIISANPGLNRAIRLRRQKESGAFNGIIHKNEQYDATLCNP-VTFIKKMIEESKGFLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQKQSRFIAWTF. 321
61 -10.600[Q] KOG1663 O-methyltransferase  ali follow..  17  75..........................................................TSADEGQFLNMLIKLVNAKNTMEIGVGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAIDFREGPALPVLDEIVADEKNHGTYDFIFVDAYHKRLIDLVKIGGVIGYDN....................................... 202
62 -10.400[H] COG2226 Methylase involved in ubiquinone/menaquinone biosynthesis  ali follow..  18  42.....................................................LMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMETGKVILADINDSMLKMGREKLRNIGVIGNVEAEALPFPDNTFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLE....................................... 170
63 -10.300[R] COG4122 Predicted O-methyltransferase  ali follow..  17  44..........................................................IAPEQGQFMALLVQLLGAKKTLEVGVGYSSLIVALALPAEGKLVACDINEEFTAIAQRYWQKAGVDHKIDLYLAPALETLDKLLVAGDFAFDKSNYDNYYERSLQLIRSGGVIAIDN....................................... 170
64 -10.200[J] COG1867 N2,N2-dimethylguanosine tRNA methyltransferase  ali follow..  14  30.....................................................VFYNPRMALNRDIAVVLLNVLKPRIVLDALSATGIRGIFALETPAEEIWMNDISEDAYNLMKKNVLLNFKGELEESNGRAVLKSEKTLMAEKHRYFHFIDLDPLDTALRSVKRKGILGITATDGAPLCGAHPKACMRKY...................... 186
65 -10.200[M] COG0357 Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division  ali follow..  15  62.......................................................................PYLQGERFIDVGTGPGLPGILSIVRPEAHFTLLDSLGKRVRFLRQELKLENIEPVQSRVEEFPSEPPFDGVISRAF----ASLNDMVSWCHHLPGEQGRFYA......................................... 163
66 -10.100[Q] KOG0024 Sorbitol dehydrogenase  ali follow..  18  159.............................................................SVGIHACRRGGVTLGHKVLVCGAGIGMVTLLVAKAGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDI.................... 294
67 -10.000[A] KOG0821 Predicted ribosomal RNA adenine dimethylase  ali follow..  14  41............................................................LRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKNVHIIGNLPFSVS-TPLIIKWLENI.................................................. 158
68 -9.820[E] KOG2352 Predicted spermine/spermidine synthase  ali follow..  13  15...................................................YWPFEWGDYNSLSNVIDKYLK--PKDTFLQLGCGNSELATQLYDNGFHCIHSIDVEPSVIATQIRKGDAANLSMADEAHTIVIDKGTLDALLPPS---DEALVTKMFEEVHRVLASGGRYIIVTLAQPHITEFWINH.......................... 171
69 -9.580[R] COG2933 Predicted SAM-dependent methyltransferase  ali follow..  14  211..........................................................................NGMWAVDLGACPGGWTYQLVKRNM-WVYSVDNGPMAQSLMDTG---QVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNL......................................... 305
70 -9.560[J] KOG2187 tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes  ali follow..  16  277..............................................ISPTAFFQVNTVTAEKLYSIAGDWADLGPDTLLFDVCCGTGTIGLTLAHR-VGMVIGIEMNASAVADAERNATINGIS.......................................................................................... 353
71 -9.500[L] COG1743 Adenine-specific DNA methylase containing a Zn-ribbon  ali follow..  20  100..........................................................................KQAKLLDPFAGFGSIPLEAIRLGVGEVVAVEFLPTAYIFLKAMLE............................................................................................... 144
72 -9.490[A] KOG2651 rRNA adenine N-6-methyltransferase  ali follow..  18  160............................................................QAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNR............................................................................................... 218
73 -9.470[R] KOG2940 Predicted methyltransferase  ali follow..  13  83..............................................................VADNLLDRLEDCK-PTAFCLGGSLGVKRLLRGRGGIEKLIMMDTSYDMIKSCRDASLDNSIETSYFVGDEEFKESSVDLIISSLGLHWTNDLPGSMIQCKLALKPDGLFLAAILGGETLKE............................... 212
74 -9.120[J] COG5459 Predicted rRNA methylase  ali follow..  138.........................................................QNYGSIFQSLKELQKRVKPQRILDVGYGPATGIVALNDIEMQERAKIILSRQLNEVVDTEVMTKKINIMTNLRSSIPASKEYDLIILTHQLLHPIQVDENIEHYLNILAPGGHIVIIERGNPM---EIIARARQITLRPENFPDEFG.......... 338
75 -9.100[L] COG0270 Site-specific DNA methylase  ali follow..  15  71..........................................................................QAVKAISFFSGAMGLDLGFEKAGIEILLACEVDKYCRQTIVANGDIAAYSAQDILDHANLAKEDVDIMLGG---FKDERGNIFLKYIELILQIRPKYAVIE....................................... 189

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.