current user: public

If you have questions about the server, please let us know.

Query: [S] COG4050 Uncharacterized protein conserved in archaea, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MKIAIFPPNSLILADLVERRGHEPLVIQKEIKKKVTDPEIDSPPFNITEEDPIRGLKYAAIEVPSGVRGRMSIFGPLIEEADAAIIMEEAPFGFGCIGCARTNELCVFQLRKRGIPTLELKYPRTREETIDVVNKINNFLDELEAQNGLast
1 -98.600[S] COG4050 Uncharacterized protein conserved in archaea  ali  100  1MKIAIFPPNSLILADLVERRGHEPLVIQKEIKKKVTDPEIDSPPFNITEEDPIRGLKYAAIEVPSGVRGRMSIFGPLIEEADAAIIMEEAPFGFGCIGCARTNELCVFQLRKRGIPTLELKYPRTREETIDVVNKINNFLDELEAQNG 148
2 -8.160[E] COG1775 Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB  ali follow..  15  268............FSEFFAERNACLVADTYTNAWTGFISIDKSDIFWSMAE------TYTFIYLNIGLEHMAEAINRLIDYVDGAVIHSNR-------SCKPYSFGQYELQKMIEVPSVIIEADMVDSRTFSVETRLEAFLEMLR.... 391
3 -6.640[S] KOG3214 Uncharacterized Zn ribbon-containing protein  ali follow..  12  20..........................................................................................DTTFTCLFCNHEKSVSCSLDKQSGVGNLHQSHQCLITALSAPIDVYSDWIDACDAVA. 81
4 -6.150[M] COG5434 Endopolygalacturonase  ali follow..  14  312IKASGGATRNLLFAHNHFYYGH--LSIGSETDGGVSNMQVTDLAMDGNDSSGGNGLRIKSDISRGGKVNNIVYNGICMRNVKEPLVFD............................................................ 398
5 -6.080[O] COG2999 Glutaredoxin 2  ali follow..  22  4.........................................................YIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIG-------------QKMVPILQKDDSRYLPESMDIVHYVDN.......... 71
6 -6.020[S] COG3580 Uncharacterized protein conserved in bacteria  ali follow..  11  205......PEINHGIPELINSFDMAVLTEDSIAHLGNVERPLRIVDQWVYHSRLYAAASFIA------------------EDNLELVQLNS----FGCGLDAVTTDQVEEILDQYGKIYTLIKIDEGSNLG-AIRIRIRSLKAAMGERE. 323
7 -5.860[R] COG2107 Predicted periplasmic solute-binding protein  ali follow..  14  58HAYALLDDKYRILSAGASVGDGYGPVVVAKSEISLDGKRIAVPGRYTTANLLLKPVEMPFDRIIQAV---------LDEEVDAGLLIHEGQITYADYGLKCVLDLWDWWSEQVKLPLPLGLNAIRRDLSVEVQEEFLRAMRE...... 197
8 -5.840[S] COG3581 Uncharacterized protein conserved in bacteria  ali follow..  16  250..............................................................................GGTENVICMQP----FACLPNHVTGKGMIKELKRRKANIAAVDFDPGASE-VNQLNRIKLMLSTAFKNL. 315
9 -5.800[S] COG2861 Uncharacterized protein conserved in bacteria  ali follow..  11  5ISVAIIPPYARARNQEAKSQGRDILIHMPMQPVSAVKIEDGGLHLGMSAAQVNDRVNTAKNIVRDGMNNHMGSAATADPQLMTYLMLQEKHLFF---SRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKHG 157
10 -5.710[R] COG1427 Predicted periplasmic solute-binding protein  ali follow..  65.EFVLMPNLSVSANGPVG----SIFLYTKRPLEELEGSRIALTTTSATSVHLLKILLKQYVGVNVTYDEMDPSFDEMMQDHDGCLLIGDEAIVT--EVETYRYDLGELWKEYTGTSMTFAVFAVRKDAIARQRAILEELYTAFVLS.. 207

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.