current user: public

If you have questions about the server, please let us know.

Query: [C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620
# Score Template Links and tools%idFirst MLNDVVRDAEGEKVFLLGNEAIARGAIEAGIDVFAAYPGTPSSEIADTLSDACRLLRGKMDFYMEYSANEKVAFEVAVGASLAGKRAMATMKHVGVNVAADPLFSFAYVGARGGFVLVTADDPSMHSSQNEQDNRWYGKAAKLPVVEPSSVQEAKDYAKLCFDLSEKFGLPMILRSYTRLSHASGVVELGKIPEKEFSRVEWERHPETDVVLPAHARKLKPILLEKLEKIERYFNSSEMNWVDEGDGDVGIIACGLSYAYTKEALENLNLNLPVLKLSSMHPLPERLIENFVSQMKKVIVVEEVDPFVELHVRAMGLAEVYGKMNGYMPMNYEYNVGRVETGIAKALGIKPSRDYEGIVAESQKLAAKAPPRPPVLCPGCPHSASFYAIRRVVDELGDAALPSDIGCYTLGINKPLEGVDITICMGASVGVSNGLAHVLNNKIIATIGDSTFIHAGIPPLINAVYNHADFVLVILDNSTTGMTGHQPHPGTGFRGCGEAGKAVRIEDIVRGCGVEFVEVVNPYNVRKMVDVLRRALNHDGVAVVIARQPCAILWSRARRREGKIVTYKVTEDCTLCMECVNTFACPALIFDGEKVSIDQSLCVGCAVCAKICPNRAIKPAKSNLast
1 -190.000[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali  100  1MLNDVVRDAEGEKVFLLGNEAIARGAIEAGIDVFAAYPGTPSSEIADTLSDACRLLRGKMDFYMEYSANEKVAFEVAVGASLAGKRAMATMKHVGVNVAADPLFSFAYVGARGGFVLVTADDPSMHSSQNEQDNRWYGKAAKLPVVEPSSVQEAKDYAKLCFDLSEKFGLPMILRSYTRLSHASGVVELGKIPEKEFSRVEWERHPETDVVLPAHARKLKPILLEKLEKIERYFNSSEMNWVDEGDGDVGIIACGLSYAYTKEALENLNLNLPVLKLSSMHPLPERLIENFVSQMKKVIVVEEVDPFVELHVRAMGLAEVYGKMNGYMPMNYEYNVGRVETGIAKALGIKPSRDYEGIVAESQKLAAKAPPRPPVLCPGCPHSASFYAIRRVVDELGDAALPSDIGCYTLGINKPLEGVDITICMGASVGVSNGLAHVLNNKIIATIGDSTFIHAGIPPLINAVYNHADFVLVILDNSTTGMTGHQPHPGTGFRGCGEAGKAVRIEDIVRGCGVEFVEVVNPYNVRKMVDVLRRALNHDGVAVVIARQPCAILWSRARRREGKIVTYKVTEDCTLCMECVNTFACPALIFDGEKVSIDQSLCVGCAVCAKICPNRAIKPAKSN 623
2 -45.400[C] COG0674 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit  ali follow..  18  2..........KKMKTMDGNTAAAHISY-AFTDVAAIYPITPSSPMAEHVDEWATQGRKNQKVKIMEMQSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKIAGELLPGVFHVSARALATHSLNIYGDHQDVMARQTGCALLAEGSVQEVMDLSAVAHLVAIKGRVPFINFFDGRTSHEIQKVEVMDYEDLRNEFRRRALNPDHPVQRGSNEDALPEMVEHYMGEISKITGRELFNYYGAEDADRVIIAMGSICDTIEETIDYLGEKVGVLKVHLYRPFSVEHFLKIPKTAKKIAVLDRTKEPLYLDVVKAFYNSDVRVIVGGRFGLGDTLPVHIYSVYENLKLDAPKD.............................................................................................................................................................................................................................................................................. 387
3 -39.300[C] COG1013 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit  ali follow..  18  2...........................................................................................................................................................................................................................................................................................................................................................................PTSEDYKGQVPAWCPGCGNFQILSAVKQALVELGPWEVLAVSGIGQSGKLPHYMKCHTFNGLGRTLPVATAAKLANHSHVIAVAGDGDCYGEGGNHFLHAIRRNPNITLIVHDNQIYGLTKGQASPTTAKGTRGVPAEPMNPLALAISQDCSFVARGFAGDPEYLKELMKAAITHKGFSLLDILQPCVTFNKVNTFK............................................................... 208
4 -26.100[H] COG1165 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase  ali follow..  12  2.........SVSAFNRRWAAVILEALTRHGVRHICIAPGSRSTPLTLAAAE-------NSAFIHHTHFDERGLGHLALGLAKVSKQAVIVTSGTAVANLYPALIEAGLTGEK--LILLTADRPDCGANQAIRQPGMFASHPTISLPRPTQDIPARWLVSTIDHALGTLH-GVHINCPFA--------------------EPLYGEMDDTGLSWQQRLGDWWQDDKPWLREAPRLESEKQRDWFFWRQKRGVVVAGRMSAEEGKKVALWAQTLG-------WPLIGDVLSQTGQPLPCAIVVQLGSSLTGKRLLQWQASCEPEEYWIVDDIEGRLDPRRLIANIADWLELHPAEKRQPWCVEIPRLAEQAMQAVIACRDAFGEAQLAHRISDYLPEQGQLFVGNSLVVRLIDALSQLPAYPVYSNRGASLSTAAGVQRASGKPTLAIVGDLSALYD-LNALALLRQVSAPLVLIVVNNNGGQIFSLLPTPKSERERFYLMPQNVHFEHAAAMFELKYHR---PQNWQELETVLADAWRTPTTTVI............................................................................... 533
5 -22.600[EH] COG0028 Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase]  ali follow..  11  28......EKIVAEDTTLTTAQLMVQCLENEGVEYIFGLPGEENIRFVDALGDS--------TIRFIVVRHEQGASFMADIGRVTGKAGVCSTLGPGAINLLLGTADAFTDSTP--LVAISAQ-----VSLNRIYKETHQVVDLLNMFKPIGSAAIPEMMREAFEKAQTSR-AVYLCVPEDVESISGLTGLRPLARSDEADSMPGSAQI----------------------------TRAAQVLQEATKPIILAGHGAVRDYAGDALVRFSERLRINSLGTIGFMQHDYVNFGFDEADVIVCVGYDLQEFKKILHLHRYPAEIDAYPVTVSVEGN-----LSAALDGLAAIITPKEGLDAEDRKIRNLLREELEYGARADAYPVKPQRLVSDIRAAMGDSDIALVDTGALKMWMARLYPTYQ---TMAFAVPGAIGAKLAYDRKVLAVTGDGSFLMN-SQELETAIRERIPFVVLVWVDDAYGLIKWKMDLELG-RHSFVDFGNPDLVKYAESFGARGYRIEVA---ADLLPTLKKALAEDVVSVV............................................................................... 560
6 -22.200[GHR] COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes  ali follow..  11  4...............ITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYE-------VKGMRWAGNANELNAAYAADGARIKGMSCIITTFGVGELSALNGIAGSYAEHVG--VLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHR-TDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKLLETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNRHDVKAETKKLMDLTQFPVYVTPMGKGGVYVGTLSRPEVKKAVESADL---ILSIGALLSDFNTGSFSYSYKTKNIVEFHSDHIKIRNATFPGVQMK---------------ALQKLLDAIPEVVKDYKPVAVPARVPITKSTPANTPMKQEWM---------WNHLGNFLR--EGDIVIAETGTSAFGINQYAIVQVLWGSIGFTVGALLGATMAAKKRVILFIGDGSL-QLTVQEISTMIRWGLKPYIFVLNNNGYTIE-------HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIE............................................................................ 537
7 -21.000[EH] KOG4166 Thiamine pyrophosphate-requiring enzyme  ali follow..  10  78......IKYDSSFVGKTGGEIFHDMMLKHNVKHVFGYPGGAILPVFDAIYR-------SPHFEFILPRHEQAAGHAAQASRVTKKPGVVVTSGPGATNVITPIADALADGTP--LVVFSGQVATSAIGSDAQEADMVGISRSCTNVMVKDVADLPRRIDEAFEIATSGR-PVLVDLPKDVTASVLKEPIPILSSVPSMNRR----------MKEVLEEGSKNVTAKIDRVANLLKLAKKPVIFCGH---GVLANPECPTLLRKFSERLQIPVTTLSLHMLGMHGSGYANMAMQEADLILALEERGGIIHFDISP---KNIGKVVQPTEAIEGDV--YESLKLLDSATKNIKIPSRFDWLSQIQTWKERFPFTFTRSAPG-PQEVIQELDKQTSDIKDKVTITTGVGAHQMWAATFYRTSGGLGTMGFGLPAAIGASVAAKDIVIDIDGDASFSMT-GMELATVRQFDIPVKILILNNEEQGMVTQWQNLFYEKRYSHTHQKNPNFVKLADAMGIKALRVEKR---EDLAKKMKEFLSTKGPVLM............................................................................... 639
8 -20.400[R] COG4032 Predicted thiamine-pyrophosphate-binding protein  ali follow..  13  3..............VVNPEEKVIEIMKQTGIDLAATLPCDRIKNLLPLVSE---------NFPEIKLTREENGVGICAGIYLAGGKPMMLIQSTGLGNMINALESLNVTKIPLPILASWRGVYKEGIEAQVPLGAHL-----PSILEGAGLTEKLPLLENVILDAFENSRPHIALVSPKVWEASECCAWQA................................................................................................................................................................................................................................................................................................................................................................................................................................................ 173
9 -20.200[EH] KOG1184 Thiamine pyrophosphate-requiring enzyme  ali follow..  12  45...............ATLGRHLARRLVQAGVTDVFSVPGDFNLTLLDHLMA-------EPDLNLIGCCNELNAGYAADGARSRGVGACVVTFTVGGLSVLNAIAGAYSENLP--LICIVGGPNSNDYGTNRILHHTIGLPDFSQELR-NNLDDAHEQIDKAISTALKESKPVYISVSCNLAAIPHHTFSRDPVPFSLAPRLSNKMGLEAAVEPVMVGGPKLRVAKACDAFVELADASGYALAMMPSAKIGTYWGAVSTPFCSEIVESADA---YIFAGPIFNDYSSVGYSLLLKKEKAIVVQPDRITVANGPTFGC---------------------ILMSDFFRELSKRVKRNETAYENYHRIFVPEGKPLKCESREPLRVNTMFQHIQKMLS--SETAVIAETGDSWFNCQCGYEFQMQYGSIGWSVGATLGYAQASEKRVLAFIGDGSF-QVTVQDISTMLRNGQKTIIFLINNGGYTIE---------HDGPYNVIKNWNYTGLVDAIHNGECWTAKVRYEEELVEAITTATTEKKDCLCFIE............................................................................ 577
10 -20.100[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  20  1.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MNTLFGKAKEEARVTTLVNFTGDWRTFMPVIDESKCVKCYICWKF--CPIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREE 104
11 -19.500[R] COG3960 Glyoxylate carboligase  ali follow..  10  4...............MRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRK-------HGGIRHILARHVEGASHMAEGYTTAGNIGVCGTSGPAGTDMITALYSASADSIP--ILCITGQAPRARLHKEDFQA--------EAIAKPREAALVPRVLQQAFHLMRSGR-PVLVDLPFDVQVAEIEFDPDMYEPLPVYKPAASRMQIEKAVEMLIQAERPVIVADAAALLQQFAELTSVPVIPTLMGWAGMVGLQTAHRYGNATLLASDM---VFGIGNRFANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLG----------IVSDAKAALTLLVEVAQEMQKAGRLPCRKEWVADCQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFG--RDVCYVTTIGLSQIAAAQMLHVFK---PLGWTIPAALGVCAADKRNVVAISGDFDFQFL-IEELAVGAQFNIPYIHVLVNNAYLGLIRQSQR--ENINSSEVNGYGVDHVKVAEGLGCKAIRVFKPEDIAPFEQAKALMAQYRVPVVV............................................................................... 551
12 -19.000[EH] KOG1185 Thiamine pyrophosphate-requiring enzyme  ali follow..  13  63......KLRNHDGSNMDGASITAAALKSQGVEYMFGVVGFPVIEVGMAAQAH--------GIKYIGCRNEQAAAYAAQAGYLTGKPVALVVSGPGILHAIGGLANATVNCWP--VVCIGGT-----ADVDLENRGAFQEWSQQESVRNTSLHTIPAHIEKAVRCAMYGR-AVYVDLPGNLVLTSTEEEISFPPQVPLPAPVSIPPI------------------AEIEKAIDTLKSAKKPLVIVGK---GAAWSERGATQVQQFLTKSKLPWLATPGGK-HPRFIGQARSLAREADTVFLIGARFNWIVKVVQIDICPEEFHQVKTEVPLLGDIGEAELTPRLGDWTYDESTEWFKKLRENAEKNRAAVEKFVDDHSTPLNYYAAYQPIREFLA--NNDVIVINEGANTMPSRLPKRRLDA--TMGVGHGFSLAAALWAKTKVLVVQGDSAFGFS-AMELETIARYNLPVVTVIINNSGIGLLPEDDKAIEGDRTLALPVLSCRYEEMCKAFGGAGTVVRTV---PEIKAALEKAFQKTDGPTVI.............................................................................. 611
13 -18.300[E] COG3962 Acetolactate synthase  ali follow..  11  2...........KTIRLTAAQAMVRYLAAQMNEHVWAIFGGNVAGIGEALYGIRD------ELPTYRGQNEQSMAHAAIALRRRRAMAVTSSIGPGAANMVTAAALAHVNRLP--VLLIPGDVFANRGPDPVLQQLEDFGDGTMTVND-MRPEQLLTALPRAMRTMTDPA-PVTLAFCQDVQAEAYDYPVSFFEKRIWRQRRPEPDVVEF--------------------------EEALAALKAAKNPVIVAGGGVHFAGATETLKRFAETHSILNFGPVGVTGAESANIVSEKADLVFGVALFKNPSRKILALNVQPYDSAKHDA-ISLTADA--KIGLEKLSAALGSHRYAAPDAGLKAAWFEKADADTAAPGEEHVNSLPTDMQVIGAVQRQRDNTVVMCAAGTMPGELHQLWKSKL---CMGYEVAGGLGIKMAEDRDVIVMVGDGSYMMM-NSELATSVAMGVKITLVITDNRGYGCINRLQM-NNLYAHTNVNPIAIDFVAHAGSMGADARKVSTI---TELEEALAAARASSRTTVV............................................................................... 563
14 -18.100[C] COG1146 Ferredoxin  ali follow..  26  40......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TIDYDKCVTCGICFVT--CGVFDFDKKEVARPYNCMVACQTCMNLCPTGAISFPDAS 100
15 -17.700[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  14  12............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................XLLGLAFGAILGYASRRFAVEDDPVVEKIDEILPQSQCGQCGYPGCRPYAEAISCNGEKINRLKIAELLNVEPQPLDGEAQELTPARMVAVIDENNCIGCTKCIQ--ACPAIVGATRAMTVMSDLCTGCNLCVDPCPTHCISLQPVA 168
16 -17.000[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  13  1....................................................................................................................................................................................................................................................................................................................................................................................................................................................................MSLTMRIFTASRNGQ--RLFGSHGARLLAAQRAEPKDIVEVPKGYVYVNNKELSMEFADITDRAASTMFFGELRGFAVTLAHI--FKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAI--CPA-SRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPN. 177
17 -14.800[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  22  6.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................INVVHGTFTQLR--SLVMIFYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVA--CPV-RWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPD. 121
18 -14.700[C] COG1145 Ferredoxin  ali follow..  14  1........................................................................................................................................................................................................................................................MHHSHHLEIYEKLREKLNKAPIG-----------LPKTVSGVEKELLSVLFDEEEAKIAVHMPFIRFTAEQLAERTG--------KSLEYVEKILNEMAKKGTVWKGEKDGQTYYRLFP--------VIVGFAETPFWPGPGKDPRQEKLARLWSQYRKEGFLDEIGDREHPIMRALPERDTISEKSEILPYEDAVKLVKERDYIAVGYCPCRVMARLVGEGCRHSIENCIHMGSVGKYMVEHGLGRRISADEAIEILRQSNREGL-----------------VHLTERSKHVATICNCCSDCCVFFKAVHEHSSYLATVDTSRCIACGICML--RCPKAKINREPASVDAEKCLGCGVCVPTCPMEAIELVERD 341
19 -13.900[C] COG0022 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit  ali follow..  14  1...DPDIPEGTEMVMTTVREALRDAMAEE---FVMGEEVAEYQGAYKITQGLLQEFGERR--VIDTPITEHGFAGIGVGAAMTGLKPIVEFMTFNFSAAKTLYMSGGQMGAPMVFRGPSGAAARVGAQHSQCYAAWYSHIPGLKVVMPYTAADAKGLLKAAIRDPN----PVIFLENEILYGQSFEVPKLDDFVLPIGKARIHRKG----------------------------------------KDATIVSFGIGMTYAIKAVAELGIDVELIDLRTIRPMDLPTVIESVKKTGRLVTVEEGFPQVGDFIANQVMRAAFDYLDAPILTIA................................................................................................................................................................................................................................................................................................... 302
20 -13.300[HI] COG1154 Deoxyxylulose-5-phosphate synthase  ali follow..  14  324...............IFGDWLCETAAKDSKLMAITP--AMREGSGMVEFSRKFPD-------YFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHVAIQKLPVMFAIIVGADGQTHQGA--FDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYND----PTAVRYPR---GNAQGVALTPLEKLPIGKGLVKRH----------------------------------------GEKLAILNFGTLMPEAAKVAE--ALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENMGGAGSGVNEVLMAHRKGTQEEARAELG-LDAAGIEAKIKAWLA................................................................................................................................................................................................................................................................................... 620
21 -13.100[C] KOG0524 Pyruvate dehydrogenase E1, beta subunit  ali follow..  15  45..................NSAMEEEMKRDDRVFLIGEEVAQYNGAYKISRGLLDKFGPKR--VIDTPITEMGFTGLATGAAFAGLRPICEFMTFNF-QAIDHIMSGGIQACPIVFRGPNGPAAAVAAQHSQHFAPWYGSIPGLKVVSPYSAEDARGLLKAAIRDPN----PVVVLENEILYGKTFPISKEALSE-------------------------------------DFVLPFGLAKVERPGKDITIVGESISVVTALEAADKLGVEAEVINLRSIRPLDINTIAASVKKTNRIVTVDQAYDYLDAPVERVSMADVPMPYSHPVEAASVPNADVVVAAAKKCLYIK................................................................................................................................................................................................................................................................................. 366
22 -12.900[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  24  5..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................VIADSTLCIGCHTCEA--ACSETHRQHGLQSMPRLRVMLNEKCHHCEDAPCAVVCPAITRVDGAVQLNESLCVSCKLCGIACPFGAI...... 97
23 -12.500[C] COG0348 Polyferredoxin  ali follow..  18  188............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DLFIVEHGWCGAAYGVIGAKGLFRIKVEHRQQCDNCMDCYNV--CPEHAKKSESPLVLSKDCISCGRCIDVCPEKVF...... 276
24 -12.400[C] COG2440 Ferredoxin-like protein  ali follow..  17  14.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LYQNRYLVDPGRPHIKVRPHERPSANLLALTHICPAELNDKGQVETTSDGCMECGTCRVLCEASGEIV.... 84
25 -11.900[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  17  11....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EEDLNPDFLEELSELVEPVFEEEEVLSV--------------------------QACYQCGTCTG--SCPSGRRTSVDEVIKSDMCTTCYTCYERCPRGV....... 99
26 -11.900[G] COG3958 Transketolase, C-terminal subunit  ali follow..  14  57..............................................................VINCGIMEANVIGTAAGLALTGRKPFVHTFTAFASRCFDQLFMVKVIASDAGVTA----CHNGGTHMSFEDMGIVRGLAHSVVLEVTDAVMFADILRQLMDLDGFYWLRTIRKQARSIYAPGSTFTIGKGNVLR------------------------------------------------EGDDITLIANGIMVAEALEALEQEGVSAAVIDMFTLKPIDRMLVKNYAEKTRRIVTCENHSSAVAEVLVENCPVPMVGTQDFLQKEYG-LTAEAIVEAAKSLL.................................................................................................................................................................................................................................................................................... 317
27 -10.700[C] COG1036 Archaeal flavoproteins  ali follow..  13  1....................................................................................................................................................................................................................................................................................................................................................................................................................................................MSFKSIAWGITGAGHFLDRSYQVFKELKQRDPELSVNTLEQKLVKISGGDYLEEIFRESEQGSSSPKVGRFLLDRYDALFVTPATSNTVSKIAYGIADSLVTNAVAQAVKGKV-VVPVDIEGSIISEMPYNIDRKQCRHCETCPPRENCPHGAITEKNDQIELLKCKGCGICKELCPYNAI...... 200
28 -10.700[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  14...........................................................................................................................................................................................................................................................INEEIQNDIMRKAVVMAQERIGANRQKMVEELGHEEWREHAKEIRNHVILDAYLYQLSEKVIQNGGHVYFAA-----------TAEDATNYIKNVAKQKNAKKIVKSKSMVTEEIG---------------------MNHVLEAEGIKVVETDLGEYILQVAEDKPSHIVVPAIHKDRHQIRKV-----AEKLGYTGSDTP--RNDFLEADIGVSGCN--FAVAETGSVCLVTNEGNLRLATSLPKTHIAVMGMERLAPTFK-EVDVLITLLARSAVGARLTGYNTWEEFHLVIVDNGRSKMLGSEFRE---------VLRCIRCGACLNT--CPAYRQIGGHGYGSISACSLCTACNQVCPVKI....... 376
29 -10.300[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  16  28................................................................................................................................................................................................................................................................................................................................................................................................................................RKLEKLIDESGVLDVVSKGDVVAVKTHFGDRGTTRTLRSVFIRTVVEKVIEAGGRPFVTETTGLGMLRPRCTAVGRINIAEENGYTHQTAPIIIADGLLGFDYVEVPVEGKHLNSVKVAKAIAECDAVICCTH-CVAKPSKFDIHMSDYPQIDEEKCTKCDECVKI--CPSNA---EDYQINREKCVKCLGCSEACDYGAVKTFWVF 250
30 -10.200[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  15  59........................................................................................................................................................................................................................................................................................................................................................................................................................................................................VLDALLYIKNNIDPTLTLRRSCREGICG-----SCAMNIDGTNTLACTKGMEEIKGTVKVYPLPHMPVVKDLVPDLSNFYAQHRSIEPWLKTVSPTPAKEWKQSHEDRLKLDGLYECILCACCST--SCPSYWWNGDRWLIDSRRCHTIMNCAQACPKGL....... 241
31 -9.820[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  21  77...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KVCPSGAMHKREDG---FVVVDEDVCIGCRYCHM--ACPYGAPQYNAEKGHMTKCDGC-ICVESCPLRALEFGPIE 156
32 -9.700[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  11  112.........................................................................................................................................................................................................................................................GTAAHAGHARHLVDHLIERLGEDYKIDLGSNVDIEAPITRTVMGKRPATL-LREVMDYAEEQMSHLLSACHTGQEGDSK----DFESKAFHAGLMDDLTREVADLAQIVALDLPK--------------GDEDAPLVELGFGTIDTEKPVVLCIG----------------------PGADIVDYLDENEMEDQVEVCGDVTRYNEAAKVVGPLSKQLRFIRSGVAD-DEQCVRTDVLEEALKNRSAVIATTDKMCLGLPDMTDEDPDKIVNDLINGNIEGALILDPEKVGEVAVKTAMKLAPIRKSLKKLPDIDEIIELASECTDCGWCQR--VCPNKAADGDLSKLEEELCYTCGRCEQECERNI....... 463
33 -9.580[C] COG1141 Ferredoxin  ali follow..  13  39.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................GGILRQKGVYVDEITCIGCKHCAHV--ARYIEPDYGRSRVDGDAEEVIQEAIDTCPVDCIHWVDYT 108
34 -9.530[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  13  72........................................................................................................................................................................................................................................................................................................................................................................................................................................................................VLDALIKIKNEVDSTLTFRRSCREGICGGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSI----------PYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCST--SCPSYWWNGDRWMIDSRRCHTIMNCTRTCPKGL....... 257
35 -9.420[G] COG0021 Transketolase  ali follow..  13  347........AKAETIATRKASQNSIEILAKELPELVGGSADLTPSNLTDWSNSVSVTRDKGGNYIHYGVREFGMGAIMNGLVLHGVKPFGATFLMFSEYERNALRMAALMKINPVFVIGLGEDGPTHQPI--EQTATLRLIPNMDVWRPCDTAESLVAWAEAVKAADH---PSCLIFS---------------------------------------RQNLKFQARSEQQLNDIKRGGYVISEAQGNAQAVIIATGSEVELALEALAAQNIAVHVVSMPSTNVFDRQDTAAVLPESLPRIAVEAGHADGWYKYVGLNGAVV-APADLLFKAFG-FTVDNVVDTVKSVL.................................................................................................................................................................................................................................................................................... 659
36 -9.250[C] COG2609 Pyruvate dehydrogenase complex, dehydrogenase (E1) component  ali follow..  509ILNILLKDKNVGKHVVPIVPDESRTFMEGLFRQVGIWNQEGQKYVPQDHDQLMFYKESQTGQVLQEGINEAGAMCDWIAAATSYSTGIQRIGDLCWAAGDMRSRGFLLGGTAGR-TTLNGEGL---QHEDGHSHVYHAAIPNCISYDPTFQYELAVVMQDGLRRMYVEQEDVYYYLTVMNENYEHPEMPAGAEADIIKGMYLFKKGVE----------------------------------NSNAPRVQLLGSGTIFREVIAAAELLGVESDLWGCPSFTELAREGNAALKGVRGPVIASTDYVRTFAEQIRAFVPRRYVVLGTDGFGRSDEVDRYWVTVASLKALADEGVLPREKVAEALKKYNLDPNKPNP......................................................................................................................................................................................................................................................... 893
37 -9.190[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  13  72EIQKDIKELGLNRVVVAAEPTFRRCVEEAGLNVHMDDPEGATEKAKDLVRMAVAKARLLEPL--EASKVSVDDKALVIGGGVAGIQTALDLADMGFKTY---------------MV--------------EKRPSISGRMGQLDKTFPTLDCSMCILAPKMVDVGKHDN--IELITYAEVKEVDGYIGNFKVKIEKKPRYIDEDLCTGCGSCVEVCPIMTKAVYIPFPQAVPLCATIDKDYCIECMLCDEICERGAVKHDQEPEEIEIEVGTIIVATGYDAYDPTEKLEYGYGRHTNVITGLELERMINAS-------------------------GPTDGKVIKPSDGEKPKRVAFIHCVGSRDEQIGKPYCSRVC--CMYIKNAQLIKDKMPDTEVTLYYMDIRAFGKGFEEFYKRSQEKYGIKFIRGRPAEILENPDLTLTVRSEDT----------LLGKVTEYDYDMVVLGVGLVPPEGSEKLRGLSKSADGFLMEAHPKLRPVDTLTDGVYLAGVAQGPKDIPDAVAQASG--------AAARAAIPMVKGEVEIEPIVAVTDSDVCGGCEVCIE--LCPAISIEEGHANVNVALCKGCGTCVAACPSGAM...... 646
38 -9.060[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  14  44.........................................................................................................................................................................................................................................................................................................................................................................................SGGLTVSHLRFGENRIRSAYLIQQADFVSCSTSAYLRSYDLLKGLKPGGTFLAAMREYIAKNNIQFYTLNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKALADLKASAIATYGKKDMAVAEKNILAMDQ--TVANLHKVEVPESWANPVLTAEASTATEKPAYVKNIL-PGTAAYEKRGIALEVPEWISENCTMCNECA--FVCPGKDGLRYRIQVSPMDCTGCNLCAETCPAKALVMKPFE 355

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.