current user: public

If you have questions about the server, please let us know.

Query: [R] COG4624 Iron only hydrogenase large subunit, C-terminal domain, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .
# Score Template Links and tools%idFirst MDALIRPPMSFFADLPKDNKKCIKIGSPLALSLSDCLACSGCVSADEAGALSEDLSFVLDLSPQTSFVLSPQSKINIFNLYREDGMEYREFEAVLSSFLRSKFNIHRIVDTSYLRSKIYEETYREYMATNHLIVSACPGVVTYIERTAPYLIGYLSRVKSPQQMAFSLVKGSRTVSVMPCQDKKLENGRDGVKFDFILTTRGFCKALDSLGFRRPARASGKSLCSMEEAETTQWNIGTSSGGYAEFILGKHCVVETREIRNGIKEHLLDDGRTISQITGLENSINYFKSSKTKGPRHKMTEIFLCKNGCIGGPGQERVNDVEMDIREYDRNGREQPRIFYSSPGLEEKRVFREVKAKRVDLRVDWLast
1 -113.000[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali  100  1MDALIRPPMSFFADLPKDNKKCIKIGSPLALSLSDCLACSGCVSADEAGALSEDLSFVLDLSPQTSFVLSPQSKINIFNLYREDGMEYREFEAVLSSFLRSKFNIHRIVDTSYLRSKIYEETYREYMATNHLIVSACPGVVTYIERTAPYLIGYLSRVKSPQQMAFSLVKGSRTVSVMPCQDKKLENGRDGVKFDFILTTRGFCKALDSLGFRRPARASGKSLCSMEEAETTQWNIGTSSGGYAEFILGKHCVVETREIRNGIKEHLLDDGRTISQITGLENSINYFKSSKTKGPRHKMTEIFLCKNGCIGGPGQERVNDVEMDIREYDRNGREQPRIFYSSPGLEEKRVFREVKAKRVDLRVDW 365
2 -84.200[Y] KOG2439 Nuclear architecture related protein  ali follow..  22  10LNDFISP--------ALACVKPTQVSGGKKITLSDCLACSGCITSSEEILLSSQSHSVFQQDKFLVVSVSPQCRLSLAQYY---GLTLEAADLCLMNFFQKHFQCKYMVGTEMGRIISISKTVEKIIAHKPLLSAVCPGFLIYTEKTKPQLVPMLLNVKSPQQITGSLIRATYHLSLMPCFDKKLEASRPESGIDCVITPREIVTMLQELNLDFKSFLTEDTSLYWDPRVHWASNLGGTCGGYAYQYVTAVQRLHPGSQMIVLEGRNSDTALRKRRTGPKANSREMAAATAATPYHSDYIEVNACPGACMNGGGLLNGEQNSLKRKQLVQTLNKRHGEELAMVDPLTAPVKQAVEKDLVSVGSTW 491
3 -18.000[C] COG1146 Ferredoxin  ali follow..  15  33..KEIEWYPTIDYDKCVTCGICFVTCGRRVFDFDKMVACQTCMNLCPTGAISFPDASYIKK................................................................................................................................................................................................................................................................................................................ 104
4 -17.300[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  20  111.........VIDENNCIGCTKCIQACPVDAIVGDLCTGCNLCVDPCPTHCISLQ....................................................................................................................................................................................................................................................................................................................... 165
5 -17.000[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  14  47.........VIDESKCVKCYICWKFCPEPAIYIKECKGCGICANECPTKAITMVREE.................................................................................................................................................................................................................................................................................................................... 104
6 -16.600[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  15  114...........GEERCIACKLCEAICPAQAITIEACIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNGDKWES.......................................................................................................................................................................................................................................................................................... 204
7 -14.900[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  15  58...........GEERCVACNLCAVACPVGCISLQRCIFCGLCEEACPTTAIQLTPDFEMGEFKRQDLVYEKHDLLI................................................................................................................................................................................................................................................................................................. 141
8 -14.700[C] COG1145 Ferredoxin  ali follow..  11  281.......LATVDTSRCIACGICMLRCPMKAIKAKICLGCGVCVPTCPMEAIELVERDGMTYVQELLADKGRDPSGLF................................................................................................................................................................................................................................................................................................ 368
9 -13.800[C] COG0348 Polyferredoxin  ali follow..  11  222...........HRQQCDNCMDCYNVCPEPLVLSKDCISCGRCIDVCPEKVFIFTTRFNHSVNHS............................................................................................................................................................................................................................................................................................................. 289
10 -13.800[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  1MPPKIAEVI--DYDVCAACGACEAVCPIGAVTVKKCEGCLTCSRVCPV------------VDGFIQDELTNVRKFFGARSKDNVGSQDGGVASGILKSLFKQGKIDCAVGITRNEKWEPEVVLLTSAEDVERTRGT-----KYTSDPVLAALREAFEKYDRIAVIGV-----------PCQAHAAHLIRENVNEKIVLIIGLLCMESFHHDVMLEKIIPEILKVKLEDIRKGKFWVYTKDGEVHSVPIKDVAKFARNPCHHCCDYTSVFADISVGSVGAPDGWNSVFIRTEIGE---KYFDMVR------------EDMEIMEDPKPGLELVEKLIGMKRKGNAEHFLEVCEK............ 334
11 -13.500[C] COG2440 Ferredoxin-like protein  ali follow..  16  21.VDPGRPHIKVRPHERPSANLLTHICPAKCTTSDGCMECGTCRVLCEASGE.......................................................................................................................................................................................................................................................................................................................... 82
12 -12.800[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  13  198.........QIDEEKCTKCDECVKICPSNAINREKCVKCLGCSEACDYGAVKTFWVFGRDVSERIVECTKGVFKVQKNFAYLNFLMDITDCHPYSDLPVVPDLGIMASKDI-----LAIDRASVDLYRQAENLSGALLKDKKFWDWTDVEGM--LNYAEK----LELGTQNYRLIEIS........................................................................................................................................................................................... 363
13 -12.100[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  16  50..............LCHHCEDCAVVCPVNALNESLCVSCKLCGIACPFGAIEFSGSRPLDIPANANTPKAPPAPPAPARISTLLDWVPGI------------------------RAIAVKCDLCSFDEQGPACVRMCPT.................................................................................................................................................................................................................................. 161
14 -11.100[C] COG1140 Nitrate reductase beta subunit  ali follow..  11  181............PRLCEHCLNCVATCPSGAIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKPRIEAGQPTVCSETCVGRIRYLGV---LYDADAIERAASTENEKDLYQRQLEVFLDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMV------YVPPLSPIQSAADAGELGSNGILPD------VESLRIPVQYLAN-------------------LTAGDTKPVLRALKRMLAMRHYKRAETVDGKVDTRALEEVGLAQAQEMYRYLAIANYEDRFVEAFPEKNGC-DGCHG.................................................. 486
15 -10.800[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  39.............QACYQCGTCTGSCPSGRIKSDECTTCYTCYERCPRGVKIVDAVKAARNLAAKKGYMAKAHRMVA................................................................................................................................................................................................................................................................................................ 126
16 -10.300[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  10  57.....NVFAYYLSISCNHCDDCTKVCPSGAVDEDVCIGCRYCHMACPYGAPQYNYSRVAEGKQPICVESCPLRALEFGPI----------------------------------EELRQKHGTLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPEEV......................................................................................................................................................................................................... 205
17 -10.200[C] COG1141 Ferredoxin  ali follow..  11  49..............................VDEITCIGCKHCAHVARNT---------------------------------------------------------FYIEPDYGRSRVIRQDGDA-EEVIQEAIDTCPDCIHWVDYTELKNLEEDRK-FQVIPVVGYPVDHAVATTEKRRRKQKSKNKKSR.............................................................................................................................................................................. 151
18 -9.370[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  407.............SECTDCGWCQRVCPNEMAIEELCYTCGRCEQECERN-IPIVSMVTKAGERRVKDEKYRIRAGRGPAQDVEIRRVGAPIVLGDIPGVVAFVGCS---NYPEGGKDVALMAKEFLERNYIVVTTGCGAMSIGEYRD--------EDGQTLYEKYGGQFDAKGLVNMGSCVSN-AHVSGAAIKIANIFAQKPLEGNFEEADYILNRVGACGVAWGAYSQKAAAIATGVNRWGIPVVLGPHGSKYRRLFLGRADDEEKLKDLRTGEVIDGEPAPEHLLYAAENREEA------------VMIAKLCIRPTDTPKGRQMKLSNYIDLHRKYLGTIPDDIDRFIRTEKDIPIVYKRDW 766
19 -9.270[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  10  135..DFTHPFYRYDPDQCILCGRCVEACQQRPANLSSCVSCGLCATVCPCNALMEKSEDMLEPMIDMVKKVEPNYQTVFAVSEMEAAMRETRTKKTKTVCTFCGVGCTFEVWTKDRKILKVEPTGEGPVNKFAT----CV-------KFGWDFVNSEKRITTPLIREGNEFVPASWEDAIHLVATKLREIQAKYGNDSITTNEELMQKLARQVFETNNIDNCSRYCQAPASDGLTRTVGGADSGTVEDIESAGLVIIVGASPADGHPVLASRIKRAQKTRGQKLIVSDLRKHEMAERSDLFIHPKGTDFVWLTAVAKYIIDQNWHDQVFMENRISNVADYLAFLEPFTLEYAEK............. 521

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.