current user: public

If you have questions about the server, please let us know.

Query: [S] COG4676 Uncharacterized protein conserved in bacteria, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MNRMSLAALLSCLPLVAWADNPVKLDTPVSGWRAGDGSAANYRQVVNYPASSVNVAADQATTARIRGAIESQPKDRPATLVVNGVSMPLKVDADGSFDRPFAFPSGSNSVEVRNAAGQSRRVQFYHGGGGGEVPAKLRVLLSWDSDNTDLDLHLVTPDGDHVWYGNRSLANGATLDVDVTTGYGPEIIATPTPQKGPYLVYVNYFGGGYGSSEDGAEQAAQDLTTARITLVTEEGTPNEKQETFLVPMRKPGELTLVKRFSYPLast
1 -81.500[S] COG4676 Uncharacterized protein conserved in bacteria  ali  100  1MNRMSLAALLSCLPLVAWADNPVKLDTPVSGWRAGDGSAANYRQVVNYPASSVNVAADQATTARIRGAIESQPKDRPATLVVNGVSMPLKVDADGSFDRPFAFPSGSNSVEVRNAAGQSRRVQFYHGGGGGEVPAKLRVLLSWDSDNTDLDLHLVTPDGDHVWYGNRSLANGATLDVDVTTGYGPEIIATPTPQKGPYLVYVNYFGGGYGSSEDGAEQAAQDLTTARITLVTEEGTPNEKQETFLVPMRKPGELTLVKRFSYP 263
2 -12.500[R] COG4110 Uncharacterized protein involved in stress response  ali follow..  13  1....................................................................IADEPAPAAPTPPVVTPPPVETKISLSKVSLT--------------------KEKPAISLTKRDNFGEIRINLNWHSKGIDLDLGVELQDGYK-AFGDYRDEPYVQLKGDDRTGDVSEWLHINGREWKHIRIYAFIYEGVPSWDKTDGVVTIHVPDQPPIETRLTEGENRRTLCAI-ARLVNENGAIKVERIN.. 199
3 -7.430[W] KOG4802 Adhesion-type protein  ali follow..  11  144......AAACVESCEVDNECSGVKKCCSNGCGHTCQVPKTLYKGVPLKPRKELRFTELQSGQLEVKWSSKFNISIEPVIYVVQTHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKGSVTVTIVW-DLPEEPDIPV---HHYKVFWSWMVSSKSTKKKRRKTTDGFQNSVILEKLQPDCYVVELQAITYWGQTRLKSAKVSLHFTSTHATNNKEQLVKTRKGGIQTQLPFQRR............ 423
4 -7.060[R] KOG4525 Jacalin-like lectin domain-containing protein  ali follow..  15  19.............................................................FVIIHGRVGPRASYCPQTINVKHHENSFPEQTDLYFKAIIHVVPGDNTILFTTDDGGKLELQVYYQLLVDNPFYCIAFIV-----GKDSDLSFDAPHGAK----NDIDEGIRKLRC-YRNGYGRRSFRIEE--------------SVQPDTMSCLSPWGTERLTATINILRSDKTAEEIRSV------PPDQLFHIA..... 202
5 -7.030[T] COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1  ali follow..  18  21......................................................................................................................................TNVLIGLGWDARSTDLDASAVRNDADFIFYNNLKSSDGSMHTGDNRTGEGDESLKIKPADVDKIVFVVTIHDAQARRQSFGQVANAFDDNGVEIARYDLSEDASTETAMLFGELYRHNAEWKFRAV... 172
6 -6.190[S] KOG3306 Predicted membrane protein  ali follow..  18  35..........................................................SEDSYTITGRVKIPPSNSNVKVILNGGQKITFLRPDGYFTFH-EVPAGTHLIEVSAMGYF----------------SPVRVDVS-ARHRGKVQATL............................................................................................................. 121
7 -5.770[O] COG4934 Predicted protease  ali follow..  11 1258.................................................NPNLTILNELYISYNGNIIASEPITTSSGVLQINGNDLPYGILNLTFTIETANGQTNETSITVMNLPADEYTVNIIAPVTGSSQTGSLNITFTYTGFDDTVILYVNG-SSGNVITANVTGKNLYTITEGKGSSSLPA---------GNYTVTVLVISKDG-------------VAKQSANFDLKAPVVPPVQSSIIIEYLVIGIV--VGSLAV. 1452
8 -5.760[T] KOG2397 Protein kinase C substrate, 80 KD protein, heavy chain  ali follow..  351................................................................................................................................................EKAREARRLFDEVNTKVQDLDAKIREAEDFANSD----YGEDSAWAADRNVQQYTYQFCPFGQNTQKDTGAYSGTSLGGNKYSKMHFGDGQQ--KRSTDITIECGEENELVEVTEFRTP 492
9 -5.700[O] COG4935 Regulatory P domain of the subtilisin-like proprotein convertases and other proteases  ali follow..  13  48.......................................................................................................................................TVTVDIDTEIRG-TTTVDLISPAGIISNLGVVRPRD------VSSEGFKDWTFM--ENGVGDWKIKVKTTENGHRID-----------HSWRLKLF---GESIDSSKTETFVFGND............ 147
10 -5.700[C] COG3794 Plastocyanin  ali follow..  16  50....................................................................................................................................DMATHQLTVTW--ANTGSRNHTVTPEGASYFASGGFDTEPDARRAWQDNVEGGATYEVTLTVPGEYYYFCIPHEGAG...................................................... 140

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35