current user: public

If you have questions about the server, please let us know.

Query: [S] COG4719 Uncharacterized protein conserved in bacteria, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MFPGGTTVKTHLTLTALALTSVSFAAQAAPAATSPIKLSGATYSVAQVTENGKTTERLVDASGKGALPGSLLQMTQKVQNVSARSVNGLRLNMRVDPATIYQSATCDAAKTNTLFSIDSGKTFSANPTKTVTVTENGKATQRTVPASPSEYTNVRWELPSLAASQTVNCNLRVRVKLast
1 -75.800[S] COG4719 Uncharacterized protein conserved in bacteria  ali  100  1MFPGGTTVKTHLTLTALALTSVSFAAQAAPAATSPIKLSGATYSVAQVTENGKTTERLVDASGKGALPGSLLQMTQKVQNVSARSVNGLRLNMRVDPATIYQSATCDAAKTNTLFSIDSGKTFSANPTKTVTVTENGKATQRTVPASPSEYTNVRWELPSLAASQTVNCNLRVRVK 176
2 -25.500[U] KOG3317 Translocon-associated complex TRAP, beta subunit  ali follow..  14  45.........................................FSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVRLVDSGFHPEAFDVVG----------------------------------------------GQPTAVVDRIAPQTNFTHVLVVRPK 133
3 -12.000[T] KOG3865 Arrestin  ali follow..  11  205..................................................SSGLLHMEVSLDKEMYYHGESISVNVHIQNNSNKTVKKLKIY--IIQVADIVARIESNEGFPVGPGGTLSKVFAVCPLLSNNKDKRGLALDGQLKHEDTNLASSTILDSKTSKESLGVVQYRVKVR 340
4 -11.700[S] COG1470 Predicted membrane protein  ali follow..  546.VKSGETKTVYLKVYPSLNAMPGTYNATITVISSS---IKKEIPVKIKLIGSYNMNVNLLNYRLTITAGEEKTAMMDIFNFGNAPLTNLKITVKGPQGWDV--------------------KVDPSQIPSLSPKGRERVTITVKVPEGTPAGDYRVQITVKADQAEWQDTLRVVVR 698
5 -11.400[M] COG1361 S-layer domain  ali follow..  699LGKGSAQASFKVDVDENAKSGRYLIPLTIEYKDPTGKFRQIEVNIPVIIAEKPKLVITDVRFGEKPVQGKDVNIYITVKNVGGEQAESVVIEGVVRSSQPFTLVKRT--------------------------------------------------IGTLNPNQTGEGVITLSIE 827
6 -10.700[S] COG5316 Uncharacterized conserved protein  ali follow..  11  328.LPMG---TMRVYMRDAAGDPKFVGENAIGHTPAGSELSIKTGEAFDVSGQATLVAESRVSKRLT-----RYEMKYLLRNAKDQPVT-VELRQGGLGR-------------------------------------DSTVKAESLKGRRIDAGTLGWSV-PVPANGETVLTFTVETG 455
7 -8.790[P] COG4454 Uncharacterized copper-binding protein  ali follow..  12  6.....LALLLTALATPAFAGGTHSGGDNVMAIGEPGDKSKVTQTIQVTMKETPDGKMMFTPAKFEFKKGKTV--RFAVKNVGELD-HEFILDEQ-----------------------------------------KANLEHKAVMAKAPEMEHDNPNAISLAPGESGEIVWKF... 129
8 -8.470[S] COG4549 Uncharacterized protein conserved in bacteria  ali follow..  13  24..........................................................ITLETQEAAVGSTYKAVLRVPH-GCDGKATTAVRVQIPEGVIAVKPMPKSG------------------TLQTKKGKFEKSYQLYGQAVSDGVKEVDWSGGNLPDEFYDEFVFRATL. 122
9 -7.940[O] COG3175 Cytochrome oxidase assembly factor  ali follow..  13  43MVP------YKKICELTNINVLTTRDLDGGALRNTQVDQARTVTVEFDSNSQGPFRFRPVKNSMEVHPGEINQIVYEVVNKEGRSVSAQAIPSYAPKQAT............................................................................ 137
10 -7.900[C] COG3794 Plastocyanin  ali follow..  10  7................LAGGTTLSVGVLAGCIGPSVSKSDYDIGMVSNGFVPQEPVEGEDMATHQLTAGDTVTWA----NTGSRNHTVTAYGSGLPEGASYFASGGFDTEPDARRAWQDNV----------------------------------EGGGNISPGATYEVTLTV... 125

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.