current user: public

If you have questions about the server, please let us know.

Query: [S] COG4895 Uncharacterized conserved protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst MNGQERNSISKGLQVDIVLKADQKTGKLTRGTVKDILTKSNFHPHGIKVRLEDGRIGRDQQIVSTLast
1 -45.200[S] COG4895 Uncharacterized conserved protein  ali  100  1MNGQERNSISKGLQVDIVLKADQKTGKLTRGTVKDILTKSNFHPHGIKVRLEDGRIGRDQQIVST 65
2 -5.200[R] COG1277 ABC-type transport system involved in multi-copper enzyme maturation, permease component  ali follow..  14  112...........GPLLGIALGFDAINSERSKGTLSRLMAQPIPRDYVINAKF----VAALFINI.. 159
3 -5.070[M] COG5434 Endopolygalacturonase  ali follow..  20  328.......HFYYGHGLSI--------GSETDGGVSNMQVTDSSGGNGLRIKSDISRGGKVNNIV.. 382
4 -4.790[S] COG1935 Uncharacterized conserved protein  ali follow..  17  32.NVATALKAEPGDCVFLTPARINDLGRGVSGLVAEVRGKEVMSQS-VRLMLKPKSLGRLVQVKRG 110
5 -4.590[T] COG2206 HD-GYP domain  ali follow..  16  334.....RKPFSGYQAMKSLLA--DNARRFDPDVIKAMIQSVGIYPIGSLVLLNNSAVARVVKT... 388
6 -4.390[S] COG3798 Uncharacterized protein conserved in bacteria  ali follow..  33  55............................................ERHEVVGSDGGVGRVDHI... 73
7 -4.280[C] KOG0537 Cytochrome b5  ali follow..  25  25...........................VINGKVYNVTKFLEDHPGGDDVLLSST........... 51
8 -4.160[J] KOG1750 Mitochondrial/chloroplast ribosomal protein S12  ali follow..  26  59.............................KGVVLRVMVLKPKKPNSCRVRLTNGN.......... 89
9 -4.110[S] COG4716 Myosin-crossreactive antigen  ali follow..  15  14...PRKPEGVDQKSAYIV-------GTGLAGLAAAVFLIRDGHMAGERIHLFEEL-GSLDGIEKP 71
10 -4.100[D] COG0239 Integral membrane protein possibly involved in chromosome condensation  ali follow..  12  39........................IGCFLLAFIMPFLAEKSRISLVLLNGIGTGFIGAFTTFSA. 78

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.