current user: public

If you have questions about the server, please let us know.

Query: [S] COG4905 Predicted membrane protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst MEIFMTFIVYSFIGWIWETFYCSFKDRHFVFRGFLLGPYCPVYGFGVSAVLLLVPDTGNLFSLYLNTIVIVTVVEFIGSWILEKFFNMKLWDYSTLPFNIEGRVAVPVSLFWGVGCIILIKLVNPPVQNWIHDFNELTHSWGVILILIIFLADLVSTFIFTISTKKEVLAMIDDSDKENAAIKEFCLKHLFANHETAANRIKVLELLKNKPLKLKHYNLRRILKNYPNMNLTKKRLast
1 -104.000[S] COG4905 Predicted membrane protein  ali  100  1MEIFMTFIVYSFIGWIWETFYCSFKDRHFVFRGFLLGPYCPVYGFGVSAVLLLVPDTGNLFSLYLNTIVIVTVVEFIGSWILEKFFNMKLWDYSTLPFNIEGRVAVPVSLFWGVGCIILIKLVNPPVQNWIHDFNELTHSWGVILILIIFLADLVSTFIFTISTKKEVLAMIDDSDKENAAIKEFCLKHLFANHETAANRIKVLELLKNKPLKLKHYNLRRILKNYPNMNLTKKR 235
2 -11.200[S] COG2324 Predicted membrane protein  ali follow..  12  78.PTLGFLIPALGISVSAELL---------TSTGFPFGYYVPFFCSYLLVRAGLRHSNLPRLGQELTAIAVGATLLMSWDFVLDPASQTTMPFWVWDVPGAFFGMPYQNFAGWFCTGAIFMTVATIIWRVNKVEIPEADFSLPLAMYLGNFGFAMVMSIG............................................................................ 251
3 -8.440[S] COG3216 Uncharacterized protein conserved in bacteria  ali follow..  32...........SFQYVSKRILRLNATPTAVAAGVAAG-FFPLGSHFAIAAIVCWLISGNMVAAGLGTFVFGNPLTLPFVVGATWETGKIMLHGHMQSDERP--AHLSEMLQTLSISQLWAPVLKPMLCGAV-------PLGLVFGLLFYGITRCGMTAFREKRRKRLAEKGSLLQQQEDIVLSPPLPTRHRRA.......................................... 207
4 -8.270[P] KOG3684 Ca2+-activated K+ channel proteins (intermediate/small conductance classes)  ali follow..  407LSIPMFLRLYLIARVMLLHSKLFTDASSRS--------IGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWI--IAAWTVRACFLGAMWGYGDVPHTYCGKGVCLLTGIMG---AGCTALVVAVVARKLE-LTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKNVMYDLITELNDRSED 651
5 -8.240[S] KOG4502 Predicted membrane protein  ali follow..  11  541................YQILL------------SLQKTLSIVYFLVIFILYFYLPYPRYVRVMEFFVIIPFIPIEYL------RIN-----------WGSRGNLLLALSTVLSIPIIIILVYL--FFQNYVLFIE----EIFTYVMGFFVILETLLSLVLTITFSSS.................................................................... 666
6 -8.220[S] KOG2357 Uncharacterized conserved protein  ali follow..  13  158VSILIGYAINYFTGWIFEKNFSLLGVGEGEDSPLLL-----FYASGGLLATLELKSRHDLISRLF-HIVFAMARKKAAKTMHKELRDLQ--RFGGMVPSPGGRKWVTEELVVSESKEVAGDMITDVVLDQVFGDIKHMDDMVRLIALIPYYIDLIGRYKLSSQARNKTDGARQKQEAYKELENVRQEALQRKKAEKKKILEEAQAKLSSEALRKKEAKERAMKKSMPKVKMSR.. 476
7 -8.020[V] KOG1726 HVA22/DP1 gene product-related proteins  ali follow..  12  1.......MISSLFSRLIILFC-----------GTLY----PAYSYKAV------VKEYVKWMMYWIVFAFFTCIETFTDIFIS-------W-YYEVKVAL---------VFWG-SSTLYRKFVHPMLTRYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKGGGNLVQTIKRSYSLSDLSEPDMHRTQDELDDVMMSSMTSSAVVMRSTATGARLLRPR.............. 197
8 -7.850[R] KOG4812 Golgi-associated protein/Nedd4 WW domain-binding protein  ali follow..  143...FFMAFIFNWLGFCLSFCITNTIAGRY---GAICG-----FGLSLIKWILIVRFSDYWWIFLVLGLLL-GFVNYLKVRNMSESMAAA.................................................................................................................................................. 233
9 -7.730[S] KOG4418 Predicted membrane protein  ali follow..  87LAHFFANHSKNFDPQLLDKSSFQQIPPFDVSFRR-----THFYG----LQLNCTGNNHRNLQEYYLAAMLALTITGLMAWTV-PQCLMQGWHVINSDWLERWQFTVAITLMANLIRYSIRNSGRADTLFIVSFVHLQLTVSVNIVIIVAPKFYLSNGEPSRRSMTLGGHSGRAHPSLAKLRDNILNGTIDFAEVPIADMNPEDIRAELKRVYTQLRMYKLKNLYQ-PHISKKR.. 367
10 -7.590[T] KOG2290 Rhomboid family proteins  ali follow..  11  690HRIAIIYLLSGVTGNLASAIFLPYRAE---------GPAGSQFGLACLFVELFQSWQIARPWRAFFKLLAVVLFLFTFGLL----------PWIDNFAHISGFI----------SGLFLSFAFLPYISFGKFDLYRKRCQIIIFQVVFLGLLAGLVV.............................................................................. 820

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35