current user: public

If you have questions about the server, please let us know.

Query: [S] COG4925 Uncharacterized conserved protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MKMIPEYNGIKWMLICLGVFLLAILATGCIEQNNIDQRAISNQSEMNSSEKTVSTEPEHGLALSEMSVKITSQGHIATFQLYDTVAAKELYEQLPLELDLTNFRDAQWMFYPPKKLNATAQEAYHDGKKGELSYYDPWGDVFMLYEDFYAGDEMHRLGICINGIDEIVNMSGSMQIEKNELSQEEGETKMRISIQANGETTIYELNDGKAAKELYEQLPLTIDVEDYSNNEKIFYPPKKLDTTNTPMANAQFGTLAYYAPWEDVVMFYDRFGSAGGLYELGTVISGGEHIKNMSGTILIEKVLast
1 -114.000[S] COG4925 Uncharacterized conserved protein  ali  100  1MKMIPEYNGIKWMLICLGVFLLAILATGCIEQNNIDQRAISNQSEMNSSEKTVSTEPEHGLALSEMSVKITSQGHIATFQLYDTVAAKELYEQLPLELDLTNFRDAQWMFYPPKKLNATAQEAYHDGKKGELSYYDPWGDVFMLYEDFYAGDEMHRLGICINGIDEIVNMSGSMQIEKNELSQEEGETKMRISIQANGETTIYELNDGKAAKELYEQLPLTIDVEDYSNNEKIFYPPKKLDTTNTPMANAQFGTLAYYAPWEDVVMFYDRFGSAGGLYELGTVISGGEHIKNMSGTILIEKV 302
2 -44.100[S] COG2164 Uncharacterized conserved protein  ali follow..  14  2.......................................................................................................................................................................................GERGVEMRLRIRFESAECEVELYEEETVRAIADALPIKSTANRWGDEIYFTTQVAVEKEENSK-DVVELGDVAYWIPGKAICLFFGKTPISDDVNVIGRIVNSMEGLKGVADGESVVV. 128
3 -15.000[N] COG5567 Predicted small periplasmic lipoprotein  ali follow..  13  1.........MKNVFKTLAVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKKVDSQTQSTMPDKNDRAT........................................................................................................................................................................................................................................... 58
4 -10.800[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  16  1.........MRKGC-FGLVSLALLLLVGCRSHPEIPVNDEQSLVMESSLLAAGISAEKPVLSTSDIQPSASS...................................................................................................................................................................................................................................... 62
5 -10.200[S] COG4808 Uncharacterized protein conserved in bacteria  ali follow..  1MEF--YMKAFNKLFSLVVASVLVFSLAGCGDKEESKK-ASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTIDMEKVDFKALQGISGINVSAEDAKKGITMAQMELVMKAA.................................................................................................................................................................................... 151
6 -9.850[S] COG5510 Predicted small secreted protein  ali follow..  14  1...MIKVKFMRSALITSILVAVAFLTSACNTMQGAGQDIQVAGKKLKDSAESNKPQKGCGCPHSSA............................................................................................................................................................................................................................................ 63
7 -9.700[MP] COG3015 Uncharacterized lipoprotein NlpE involved in copper resistance  ali follow..  11  2.........VKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSWRGVLPCADEGIETSLFLEKDGTWVMNERYLGAREEP..................................................................................................................................................................................................................... 82
8 -9.440[M] COG3056 Uncharacterized lipoprotein  ali follow..  31.......ESPNMFKKILFPLVALFMLAGCAKPPTTIEVSPTITLPQQDPSLMGVTVSNGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTAR---GYMVGPNGPVNLQIIVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKN------RASYNVEGAFQASNKNIADAVNSVLTDTIADMSQDTSIHEFIKQNA............................................................................................. 225
9 -9.340[S] COG3863 Uncharacterized distant relative of cell wall-associated hydrolases  ali follow..  1MK-------LKKRVSMFLVALTMCGGLFVTPAKAVKTTNYAEEIAALQPGTTPEEIMKSASQIAKQQ------------HVKQDVILKQFYKEITADKAEGDRLAKESGMSIMGG--SSGTKKLPTSAKGNIYYTNSYGHVGMYSAADKIVESVPSDGVRQIAYNARDVEDNSIVQTVSVSSSQKTAAADWAVSKVGSFNFVNNRNTGHDGAKNCSKL-------------SAFLLKAGIDIDSNGGLGVYPRDITSSSYTTTIMTIY.................................. 245
10 -9.290[S] COG3126 Uncharacterized protein conserved in bacteria  ali follow..  16  5........QPKALWQIVGGAALAVSLTGCAHQSAEAPVAAPISTATVAASVAQSTVHGTVNIRERVAL----PDAVVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLPFNPSDIQPNARVIVSAGQLLFITD..................................................................................................................................................................... 135

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.