current user: public

If you have questions about the server, please let us know.

Query: [S] COG4991 Uncharacterized protein with a bacterial SH3 domain homologue, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MKLSARASIFTLALLVSTNAYASSAIVTSTVNLRTGPGTQYGTIGAIPNGVGIMVAGCTRGYGWCQVSYGGMTGWAASRYIAIQTGNGYTTNDNFGSTAAAVGIPLIAGIVIGSAIANSGPAWGPGPYRGWGGRPNIYNGCIGRNCQSNWGPPRPHWTDPPAGATIRVIIPISVMVSVTALVMGPACVSAAGGKAQRKTGPPDSLLSGASPDWKRVKGISLPHSFHLNAEIPYWEHGFLKRQTYPGFAQQGLast
1 -93.300[S] COG4991 Uncharacterized protein with a bacterial SH3 domain homologue  ali  100  1MKLSARASIFTLALLVSTNAYASSAIVTSTVNLRTGPGTQYGTIGAIPNGVGIMVAGCTRGYGWCQVSYGGMTGWAASRYIAIQTGNGYTTNDNFGSTAAAVGIPLIAGIVIGSAIANSGPAWGPGPYRGWGGRPNIYNGCIGRNCQSNWGPPRPHWTDPPAGATIRVIIPISVMVSVTALVMGPACVSAAGGKAQRKTGPPDSLLSGASPDWKRVKGISLPHSFHLNAEIPYWEHGFLKRQTYPGFAQQG 251
2 -34.400[T] COG3103 SH3 domain protein  ali follow..  10  1MPKLLIGLTLLALSATAVSHAEETRYVSDETWVRSGPGDHYRXVGTVNAGEEVTLLQTDANTNYAQVKDSGRTAWIPLKQLSTEPSLRSENQVKTLTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQK..................................................................................................................... 143
3 -30.900[S] COG3807 Uncharacterized protein conserved in bacteria  ali follow..  11  6......AQAQAAKGPSGLPLPRFVSLKAKSVNLRIGPSVDYAVAFRLKSGVPVEIIQ--EYDNWRRIRADGTEGWVNQALLSGDRTALAAPWM-----------------------------------------------------------------------------RSKGEGVFVNMRRDPQGTASIVARVEPGV---MLHIGECNGDWCHAE---------TQGVEGWIAQSEIWGAYPGEAFK.. 159
4 -17.600[M] COG0791 Cell wall-associated hydrolases (invasion-associated proteins)  ali follow..  11  149..........TDTQIDNIYHASRRGIMVRESLVRALPTDDNLQMSSLRPGTPVYTLTKSKDQRWQYVVSPAVTGWVHSEDIASTDQKFQLGAFINAPVSVHVAGVYYFTGRPGTILPFRHQRAGQFLIA-----------------------------PVRGSNGRAFIHWVWLSGNEFTAMPWKMTPENIAVLMKA--------MYGAPYGW-----GNFNFYNDCSAEIRSLLMPFLPRHSSAQVEAAG 377
5 -16.300[T] KOG3601 Adaptor protein GRB2, contains SH2 and SH3 domains  ali follow..  1..............MESVALYSFQATESDELAFN--------------KGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKLREASGKYFLWEEKFNSLNELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLS------FRRGDIIEVLE--RPDPHWWRGR---------SCGRVGFFPRSYVQPVH........ 216
6 -14.500[C] KOG4773 NADPH oxidase  ali follow..  10  1MLKIKRTWKTHSRILDKDPFSIEPPRKVIRALYDYTARKATEV--SFAKGDFFHVIGRENDKAWYEVPAAGTRGFVPVSHFEEIGKTVKSERDSDGSGQISFTDLT-------------------------------------TNSSTTRSSISELHSGSQPLFGIVQFDFAAERPDELEAKAGE-----------------IIIIARSNHEWLVAKPIG------RLGGPGLIPLSFIQLRDLKTGAVIK 192
7 -14.400[T] KOG4226 Adaptor protein NCK/Dock, contains SH2 and SH3 domains  ali follow..  7.................VVKYDYLAQEEQELTIK--------------KNERLKLLDDSKNW-WKVMNDSNSVGFVPSNYVRKESIVDKAKGTIKGLARGRNRSSDPEGLTKGDFVYVVEKTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEIQVV-SFKKGERLEIVDHPEHDPDWWMAR--------NASGTTGLVPRNYIEVVVNDSSSSKA 282
8 -13.700[M] COG5632 N-acetylmuramoyl-L-alanine amidase  ali follow..  13  599.ENLTTTPPFDAIEYDKGVTAYARVKTAPGNAVWTKPTEGSKLVNQLSVGKNMRILRKTVITTWYQFSIDGKVGWVDTRALDTFYKQSMEKDTNLTRYVIANKVNEAYYKVPV----------------------------------------------------------------------VDADVRWGTLAAYKGQKLTVDKQATVEGQWYRIRTSS--------TFIGWTKASNLSATK........ 770
9 -13.000[T] KOG4792 Crk family adapters  ali follow..  125................SGVILRQEEAEYVRALFDFNGNDEEDL--PFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGPPEPGPY-----------------------------AQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGE-----------------VKVTKINVSGQWE----------GCNGKRGHFPFTHVRLLDQQNPDED. 302
10 -12.300[T] KOG4348 Adaptor protein CMS/SETA  ali follow..  1.............MVEAIVEFDYQAQHDDELTISVG-----EIITNIRK----------EDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAPEKPLHEV----------------------------------PSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGD-----------------IEVVGEVEEGWWE----------VLNGKTGMFPSNFIKELSGESDELG. 163
11 -10.900[IT] KOG1118 Lysophosphatidic acid acyltransferase endophilin/SH3GL, involved in synaptic vesicle formation  ali follow..  11  294...............KPIRTPSRSMPPLDQPSCKAEPENDGEL--GFHEGDVITLTNQIDE-NWYEGMLDGQSGFFPLSYVEV........................................................................................................................................................................ 362
12 -10.100[TUZ] KOG2856 Adaptor protein PACSIN  ali follow..  17  415................DSNPFDDDATSGTEVRVRA-EGQEHDELS-FKAGDELTKMEDEDEQGWCKGRLNGQVGLYPANYVEAIQ...................................................................................................................................................................... 486
13 -9.950[U] KOG3875 Peroxisomal biogenesis protein peroxin  ali follow..  14  277................ARAEYDFAAVSEEEISFRAG-----DMLNLALKEQQ------PKVRGWLLASLDGTTGLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTLTKGAT........................................................................................................................................ 365
14 -9.310[TZ] KOG2546 Abl interactor ABI-1, contains SH3 domain  ali follow..  15  420................VVAIYDYYADKDDELSFQES-----SVLYVLKK----------NDDGWWEGVMDGVTGLFPGNYVE......................................................................................................................................................................... 470
15 -9.300[S] KOG2995 FOG: SH3 domain  ali follow..  12  635...............TKSPYCTRESRFRCIVPYPPNSDIE-----ELHLGDIIYVQRKQKN-GWYTHARTHKTGLFPASFVEP........................................................................................................................................................................ 699

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.