current user: public

If you have questions about the server, please let us know.

Query: [T] COG5040 14-3-3 family protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAEDQQQQQQHQQQQPPAAAEGEAPKLast
1 -103.000[T] COG5040 14-3-3 family protein  ali  100  1MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAEDQQQQQQHQQQQPPAAAEGEAPK 267
2 -94.300[O] KOG0841 Multifunctional chaperone (14-3-3 family)  ali follow..  63  2...DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGA---EKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN................. 245
3 -7.970[A] KOG2162 Nonsense-mediated mRNA decay protein  ali follow..  10  1MEANSADQKQKPNFLVEVNNIEKQLWTLIHSKTILHTDVSELYAKAGSTYEQIFEVEFCLWKLHYKHIDEFRKGLKTNDHAKHMKAFKLFLSKAA-EFYQNLISKVRGYYSEESGEQKSRFLCHRFLGDLQRYQEQYLKAHEHPNW-STAATYYLEAAKSWPDSGNPHN--QLAVLATYALYHC-------RSL-AVKEPFPGASNNLLLLFEKNRSSPLQSLS........................................... 235
4 -7.730[V] COG3725 Membrane protein required for beta-lactamase induction  ali follow..  61.....................................LQGVLFNVPTLLVWLLIGKVRLHYHAYLTAASRNDSHARATMAGELTMIHGVPAGCDEREYLRELQNAL---LWINFRFYLAPLFWLIVGG-TLMGYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDPVRLAGVVYAL-LPAWFASLGDFRTSQYQVLTRLAQFSLAR--EPHVDKVETPKAAVSMAKKTSFVV.................................. 270
5 -6.990[Z] KOG1840 Kinesin light chain  ali follow..  17  365..........IGDSYLSLSRFDEAICAYQKSLTALKTAKGENHPAVGSVYIRLTGKVREAKSYCENALRIYESHNLEISPEEIASGLTD---EQAITLLQKALKIYADSP-MIAGIEAQMGVLYYMMGKYMESYNTFKSAISKLRATEEAVELFEEAKCILEQECGPYHPETLGLYSNLAG-AYDAIGRLDDAIKLLGHVVGVREEKLGTANPVTEDEKRRLAQLLKE....................................... 623
6 -6.480[H] COG0314 Molybdopterin converting factor, large subunit  ali follow..  14  29...............................................................................................................................GAVVTFTGKVRNHNLGDSVKALTLEHYPGMTEKALAEIVDEARNRWPLGLVTVIHRIGELWPGDEIVFIGVTSAHR---------SSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKR.......... 149
7 -6.480[S] KOG3060 Uncharacterized conserved protein  ali follow..  13  83..GSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAAPRKRKIAILKA--RGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCM-------------------EEVLLHNPHSHLIHQRLAEIRYTMGGVENMESARTYYSQALKLNPHNLRALY---IYLCCNHLDNSRAVSSKRKELQKLSQWALEQLLTKQTIVPLEAAFGNLEI............................................. 279
8 -6.430[DO] KOG4322 Anaphase-promoting complex (APC), subunit 5  ali follow..  11  539..NSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELSSPTIALPMLLQALALSKEYRLQYLASETVLN-LAFAQLILGIP-EQALSLLHMAIILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAK-----CKERIRDVVYFQARLYHTLGKTQER--------NRCAMLFRQLHQELPSHGVPLINHL......................................... 755
9 -5.970[D] KOG1915 Cell cycle control protein (crooked neck)  ali follow..  384........LLAAQHEIRQLNLTGARQILGNAIGKAPELQLRNIDRCRKLYERYLEWSPGNCYAWRKYAEFEMSLAETERTRAIFELAISQPALDMPE--ERTRALYERLL-KHCKVWVDFAKFEASAAEHKEDEEEEDAIERKKDGIKRAREIFDRANTYNKDSTPELKEERAMLLEDWLNM-ETGFGKLGDVRVVQSKLPKKVKKRKLLFPEESETTSLKILEAAHK----WKKQKVKAGEC........................ 656
10 -5.940[S] KOG4340 Uncharacterized conserved protein  ali follow..  390.......LMAQAKIYWNLENYPMVEKVFRKSVEFCNDHDVWKLNVAHVLFMQ---------------------ENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPNRKMAKGNYEFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLL------NMSKHMIVIHDSVIQECVQFLGHCEKNTVTDESRQLKALIYEIIGWNK................................ 628

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.