current user: public

If you have questions about the server, please let us know.

Query: [DO] COG5156 Anaphase-promoting complex (APC), subunit 10, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MRQNKRRLYKRKKVLNKLTTEGGKNNTRFRSQIMDPIGINKVLDHLAPSELIKPVKSCHNKPSVLVLDDRIVDAATKDLYVNGFQEEIQYQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLDNREDDQLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPSNEPHQDTHEWAQTLPETNNVFQDAILRLast
1 -98.100[DO] COG5156 Anaphase-promoting complex (APC), subunit 10  ali  100  1MRQNKRRLYKRKKVLNKLTTEGGKNNTRFRSQIMDPIGINKVLDHLAPSELIKPVKSCHNKPSVLVLDDRIVDAATKDLYVNGFQEEIQYQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLDNREDDQLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPSNEPHQDTHEWAQTLPETNNVFQDAILR 283
2 -72.300[DO] KOG3437 Anaphase-promoting complex (APC), subunit 10  ali follow..  27  2.........................................................................................DEDITANPPPSSEEDPLAEERLGFVREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYTDYKLDESYTPSRISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKDG--NVKSIRTFMLQIAVISNHQNGRDTHMRQIRIHAPVEGKHYPLELFGKFG--TVDFQKFATIR 191
3 -14.700[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  16  1.................................................................................................................MPHKIGFVVVSSSGHEDGFSARELMIHAPTV-WRSPCQFPQEIVLQMVERCRIRKLQLL----AHQYMISSKIEFYISESLPEYFAPYQAERFRRLGYVSLC-RELKSVYVDAVGQFLKLIFHQNHVNKYNIYLVAINIIGDPADFSDESNTASRE.............. 167
4 -11.800[O] KOG1730 Thioredoxin-like protein  ali follow..  15  33................................................................................................................LRIDLERLQCLNESREGSGRVFKPWEERDRSKFVESDADEELLFNIPFTGNVKLKGIII---MGEDDDSHPSEMRLYKNDDTEREPDQTFSLNRDLTGELEYATKISRFSNVY-----LSIHISKNF-GADTTKVFYIGLRG............................. 173
5 -11.800[D] KOG2687 Spindle pole body protein, contains UNC-84 domain  ali follow..  10  225..............................................................................KEIDDAKSTKIIHSTPEKAPETAPTASLPPSSQLQPMHITRRALLGVNVANSLIGASIDHSCSSRPVWCTYDKRAT-LTVKLARFVIPKSVSY---SGIVPNHAPKLYDVVACTDSCCTKW--EYKERDGSYDEQEQFCSVPTIQNHSPINHVQFRFRENHGDMPKTCAYLIRVYGEPVDPPKETQPMTDN.............. 455
6 -9.210[O] KOG0908 Thioredoxin-like protein  ali follow..  14  124................................................................................................................ELNTFISKQECECLNEADDHNLKHALASA-GGYLQSDCDEQLILSITFNQAVKIHSLKF----KAPSHLGPKDVKLFINDMAESMNSVQDLSLAQKESGVPVNLRYVKFQNVQN----IQIFVKNNQSGGDVTQIDYIGFIG............................. 265
7 -6.860[F] KOG4145 Allantoicase  ali follow..  13  202........................................................................................................................LVVQCSDQHFGKKDNLLLPGRGVNMWETEKGHVDWVIVKLGARGYIDDALI--DTNHFKGNYPKEVILEAIDSPDHIPG-------PDAQWVTILPARKLGPHMEHVFPMTHVRMIIIPDGG----VKRLRIYG............................. 337
8 -6.860[F] COG4266 Allantoicase  ali follow..  13  202........................................................................................................................LVVQCSDQHFGKKDNLLLPGRGVNMWETEKGHVDWVIVKLGARGYIDDALI--DTNHFKGNYPKEVILEAIDSPDHIPG-------PDAQWVTILPARKLGPHMEHVFPMTHVRMIIIPDGG----VKRLRIYG............................. 337
9 -6.520[T] KOG3512 Netrin, axonal chemotropic factor  ali follow..  11  35.....................................................................................................YFEGKPRKCLPSFVNAAYGNPVQASSVQQRYGPAALTDPSNVTCWRSGPPDNVTLTLSLGKKYELTYISLSF----PRSPRPDSLAIFKSSDFGQ--QFYSSQCQKFYG----ARCINSQHDTGGAAQRFAFNTLEGRPSANDVTATDIRVVFHRLELPPQLLKVKNANAFSDEMGGSREED 275
10 -6.440[I] COG2134 CDP-diacylglycerol pyrophosphatase  ali follow..  10  65.................................................................................................................FKDRHGPLQYLLMPTYRINGTESLLEPATPNFFWLAWQARGYMSKKYGHDIPDSAVSLAINSRLGRSQDHLHIHISC--RPDVREQLDNDLTRISTRWLPLPGG-----------------------MGHEYLAR--RVTESELAQRSPFMMLAEEVPEARDHMGRYAL. 210

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.