current user: public

If you have questions about the server, please let us know.

Query: [S] COG5381 Uncharacterized protein conserved in bacteria, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MSTDQTNVRQWGEFLDPIPPSDEFLTLNFSLDRVNRLQRWRNYGLSADFLGDYFATFFPGNGADDGLSQRDTIKGSVSYIANELLENAVKYSTTDHDCPITITLHLYDHKLIFETSNISPLPTTIDYENFIKVLLEADPLELYMERLEKSALEDCEASQIGLLTMINDYQAQFGWRFVPVSGSEDLIKVTVMTHLGVEILast
1 -81.900[S] COG5381 Uncharacterized protein conserved in bacteria  ali  100  1MSTDQTNVRQWGEFLDPIPPSDEFLTLNFSLDRVNRLQRWRNYGLSADFLGDYFATFFPGNGADDGLSQRDTIKGSVSYIANELLENAVKYSTTDHDCPITITLHLYDHKLIFETSNISPLPTTIDYENFIKVLLEADPLELYMERLEKSALEDCEASQIGLLTMINDYQAQFGWRFVPVSGSEDLIKVTVMTHLGVEI 199
2 -21.900[T] COG5002 Signal transduction histidine kinase  ali follow..  11  417LMVTQNETERMIRLVNDLLQLSDSKDYQFNREWIQIVRFMSL--IIDRFEMTKEQHVEFIRNLPDRDLYVEIDQDKITQVLDNIISNALKYSPEGGHVTFSIDVNEEEELLYISVKDEGIGIPKKDVEKVFDRFYRVD----------KARTRKLGGTGLGLA-IAKEMVQAHGGDIWADSIEGKGTTITFTLPYKEE. 603
3 -20.200[T] COG0642 Signal transduction histidine kinase  ali follow..  273LKRLEGELTRMDTLAGELLTLSETSNMALEKESLKLLPFLGNLVEDNQSIAQ-QTVTLSADGKIPENTTILANESYLYRAFDNVIRNAVNYS--PEGSTILINIGQDHKHWIIDVTDNGPGVDEMQLPHIFTAFYRAD------------SSANKPGTGLGLA-LTQHIIEQHCGKIIAENIKPNGLRMRFILPK.... 456
4 -17.500[L] COG1389 DNA topoisomerase VI, subunit B  ali follow..  1..........................MSGKHREISVAEFFEKNKHILGYSNP---------------------AKAIITVVKEAVDNALDACEEAGLPDIFVRISKVDDHFKIVVEDNGPGIPREQIPKVFGKLLYGSRF--------HEIRQSRGQQGIGIVLYAQLTTGKPATVISKTPDEDRAKKVVLYINTK... 145
5 -16.800[T] KOG0787 Dehydrogenase kinase  ali follow..  11  286........................................................................VESHLNHAVFEILKNSLRATVEFHGVPIKVIVAKGQEDITIKISDEGGGISRRNIPLVWSYMFTTASPT--HDIVSANSTTPMAGFGFGL-PLARLYTRYFGGDLELISMEGYGTDVYIHLN..... 415
6 -14.200[T] COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system  ali follow..  10  447MESIAELTERVGAITDELRRFARKGH---AAGPTAMKEVVEGALMLLR--SRFAGRMDAIRLDLPPDGQALGNRIRLEQVLINLLQNALEAIGDSEDGAIQVRCEEAAGGIALTVADNGPGIAADVREELFTPFN----------------TSKEDGLGLGLAEIVSDYGGTIEVE---SGPSGTTFAVNLKKA..... 621
7 -14.200[T] COG3290 Signal transduction histidine kinase regulating citrate/malate metabolism  ali follow..  15  431........................................................................QVATLITTLGNLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDK----------------GVSTKGSERGVGLA-LVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGE. 539
8 -14.200[T] COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system  ali follow..  605LDHIENLTERMGKIVNSLRHFARKNSSDESLQPVRLNSVVEQALVLVQ--TKAKRQQIKLINTLPDDLMVMADALSLEQVLINLIVNGCDASTTFAQPWVKLALGTEQGMQRIAVIDSGQGFEHEVVDKLFTPFT----------------TTKEVGLGLGL-SICQSLVEKMQGRIALASNLEKGAMVILELQQDEK. 784
9 -13.100[T] COG5000 Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation  ali follow..  531TDTIIRQVEDIGRMVDEFSAFARMPKPEMK--AIDLRESLREASFLVEVSRADITFERIFGNEPL---KGTFDSRLLAQAFGNVIKNAAE-QKDGSHGIIRIQAGRQNGAIRIDVIDNGKGLPRENRQRLLEPYM----------------TTREKGTGLGLAKIVEDHGGRLELHDAPADFHGG---AMISIILPLA. 714
10 -12.900[T] COG3852 Signal transduction histidine kinase, nitrogen specific  ali follow..  168TKVIIEQADRLRNLVDRLLGPQHPGMHI----TESIHKVAER---VVALVSMELPDNVRLIRDYDPSLELPHDPEQIEQVLLNIVRNALQ-ALGPEGGEITLRTRRYRLAARIDVEDNGPGIPPHLQDTLFYPMV----------------SGREGGTGLGLSIARNLIDQHAGKIEFTSWPGHTEFSVYLPIR..... 348
11 -12.900[T] COG2205 Osmosensitive K+ channel histidine kinase  ali follow..  11  706ANQIRQQVLSTTRLVNNLLDMAQSGGFNLRKEWQSLEEIIG--SALYMLETTLSQHQIRVELP-DEMVLINCDASLLERVFINLLENAHKYA--GHAALLGIRAEVQGEWLNVDVWDNGPGVTIGQENLIFDKFSRGNKES------------AIPGVGLGLA-ICRAIIDVHGGRIWVEKRQEGGASFRFVLPLE... 885
12 -12.600[T] COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase)  ali follow..  11  27...........................................................VSGIANRLGYTYDDIEDIKIAVAEACTNVVDHAYDE-GGTMGLSFHLYEDRMEIIVTDQGQSFDMDAFRESLGPIDG------------SKPIQDLKEGGLGLFLINTLMD-----KVEMKEDSGVVLAMTKFLQ..... 143
13 -11.700[NT] COG0643 Chemotaxis protein histidine kinase and related kinases  ali follow..  301.GDLITSMGQLQRNARDLQES-------MSIRMMPMEYVFSRYPRLVRDLAGKLGKQVELTLVGSSTELDKSLIERIIDPLTHLVRNSLDHGIENSVGNLILSAEHQGGNICIEVTDDGAGLNRERILAKAASQGLTVSENMSDDEVTAEQVTDVSGRGVGM-DVVKRNIQKMGGHVEIQSKQGTGTTIRILLPLTLAI 511
14 -10.000[S] COG4804 Uncharacterized conserved protein  ali follow..  189....................................................FVLEFLELKDEYSESDFEEALINHLMDFMLELVGRQRRLRIDDNWFRVDLLFFHRRLRCLLIVDLKVGKFSYSDAGQM----------NMYLNYAKEHWTLPDENPPIGLVLCAEKGVGEAHYALAGLPNTVLASEYKMQLPDEKRL 331
15 -9.260[T] COG3851 Signal transduction histidine kinase, glucose-6-phosphate specific  ali follow..  11  339.ASVKQSGQLIEQLSLGVYDAVRRLLGRLRPRQLDLEQAIRS--LMREMELEGRGIVSHLEWRIDESALSENQRVTLFRVCQEGLNNIVKHADASA---VTLQGWQQDERLMLVIEDDGSGLP-----------------------------PGSGQQGFGLTGMRERVTA-LGGTLHISCLHGTRVSVSLPQR..... 499
16 -9.100[T] COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase)  ali follow..  550VTALKGRIQALSFAHDQIIRGEGGGALR---------------DLLEAELSPHRSPETTVKLEGPQITLDSRAFSVMALVLHELATNAAKYGASQNGGQLHVRWDVNENRCEISWRETLLTTLPA---------------------------PSRAGFGTALISIPYDLGGRSTIRYLP---NGLEAEILLPFRHVSS. 706
17 -9.070[T] COG4564 Signal transduction histidine kinase  ali follow..  12  269.GGAPQAIEKASDALNGAIKEVRRLSHDLRPRILD---------VALKALCERTGIETRFKADSLQETIKPEPSTALYRVVQEALTNVERHSGATR---VDIRLKGAHGKVTMTIADNGNGFAVRGLKD--------------------------PLSGLGLRNMQERMAH-FGGVLL-VETSADGTQLTARLPKS... 428

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35