current user: public

If you have questions about the server, please let us know.

Query: [S] COG5451 Predicted secreted protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MCRAPACMIASQPESLLSRTDPPAGWSRANSSRVCVGQNRILIRPTIFLSLFLTMLAISGQEGVAYAQPSKSVSEARPAEAAPPKPAPYDDKLARLSEILGAVQYLRTLCPSSGPEDWRKSMSALLAADTASEPERRQRMTAAFNRGYRSFAAIHTSCTRAAIMAEENYRNEGATLAQEIASRFGNLast
1 -91.600[S] COG5451 Predicted secreted protein  ali  100  1MCRAPACMIASQPESLLSRTDPPAGWSRANSSRVCVGQNRILIRPTIFLSLFLTMLAISGQEGVAYAQPSKSVSEARPAEAAPPKPAPYDDKLARLSEILGAVQYLRTLCPSSGPEDWRKSMSALLAADTASEPERRQRMTAAFNRGYRSFAAIHTSCTRAAIMAEENYRNEGATLAQEIASRFGN 186
2 -7.110[S] KOG2521 Uncharacterized conserved protein  ali follow..  13  324............................................................STVGYYVGRDGGYVQDEHKQDLICLSNTQTNESVKPNGVLGQI--LFDVYIPKNVEDWDIKLSETGRSRPGKRFIRRSRL.............................................. 403
3 -6.540[YU] KOG1993 Nuclear transport receptor KAP120 (importin beta superfamily)  ali follow..  13  1....................................................MQVDPVVYQLQRAVSQDPIAVKDAEGHLNNWKKEPGFFGKLYSIFRWIAIIQLRNSI-----DIIWRKNTKMSLLPE--ERDFIRCNALLGSIKSENLLSIQNALV---SRIARLDYPTEWPSLFHDLLGKLQQ 134
4 -5.950[R] COG3943 Virulence protein  ali follow..  16  30..............................................................................................DMAELYQT-KHIKTI---AEQELEEKATVNFQLTVQNENGRKVNRKIAHYS-GYRVRSARGIQFRQWATERLDEYLTKGFAIDDE....... 123
5 -5.910[O] KOG3259 Peptidyl-prolyl cis-trans isomerase  ali follow..  12  52................................................................................................PARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQEMSGPVFTDSG. 155
6 -5.900[J] KOG3166 60S ribosomal protein L7A  ali follow..  13  179.........................................................................................KAQPVVIAHDVDPIEFLPALCHKMRVPY-EARLGRLVHRKTCEDKGALAKLVGAIRTDYNDYNEIRRHWGGNGPKSVACIGKLEKAKAQELATKLG. 294
7 -5.870[U] KOG2344 Exocyst component protein and related proteins  ali follow..  11  422..................................................................................DTKSRMYNDMALSYLFLANNLHYVISKVRTSNKIAWGEVITSLFDEEMLEEHVAKERL-MRFNEGFEEAFQKQSEWVVPDSKLRDDLKDS---VTEKLTTVTTT 548
8 -5.790[O] COG3088 Uncharacterized protein involved in biosynthesis of c-type cytochromes  ali follow..  16  13.......................................................................SGSALATIDVLQFKDEAQEQQFRQLTEEL-------PKCQN----------NSIADSNSMIATDLRQKVYELMQEG-----------------------KSKKEIVDYMVARYGN 89
9 -5.740[YU] KOG1992 Nuclear export receptor CSE1/CAS (importin beta superfamily)  ali follow..  10  11.........................................................LTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLKVCASVTFKNYI-----KRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDA---SIIGREDFPQKWPDLLTEMVNRFQS 140
10 -5.570[D] COG5657 CAS/CSE protein involved in chromosome segregation  ali follow..  9...............................................................ARTLNPTTSKSAEEALKVWELQDSSFALKLLNIVKLAASLYFKNYI-----KKHWDSEEGASIRISDEVAELIKREIINLMLKSTTIIQVQLGEV---GYIANFDFPDRWDTLLPDLISKLSA 133

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.