current user: public

If you have questions about the server, please let us know.

Query: [S] COG5592 Uncharacterized conserved protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MTDLSELLMVEHSAIRILSRVVYGKESLEAFEDFNEYLVKDHVEVEEKILFPVIVDFDWEDRKGFEQTVNRIKADHKLIETLAENMLKWKRSGNDDLYNLRMPLFYKTLTDHNLSEEDQIFPRWKKLEAETRENALKEAMDIILDTGLDRYSRNTGISREFLAYIEPDVIRLast
1 -66.500[S] COG5592 Uncharacterized conserved protein  ali  100  1MTDLSELLMVEHSAIRILSRVVYGKESLEAFEDFNEYLVKDHVEVEEKILFPVIVDFDWEDRKGFEQTVNRIKADHKLIETLAENMLKWKRSGNDDLYNLRMPLFYKTLTDHNLSEEDQIFPRWKKLEAETRENALKEAMDIILDTGLDRYSRNTGISREFLAYIEPDVIR 171
2 -44.600[S] COG3945 Uncharacterized conserved protein  ali follow..  14  2MLNSIKTLMEEHTVILKALEILNVIDINIIIDFIKNFVDNCHHVKEEKVLFDFLEHK-----GMVGGPIYVMVYEHNKLRDIINRIEARYN--EFEELREDLNSLIVLLASHIDKENNVLFPTAESLLSDDENKVIYEKFERIEEFGKERHERYIELIDTLYGRYINKK.. 172
3 -28.500[S] COG2461 Uncharacterized conserved protein  ali follow..  94.GHPIHTMKLENQVITSLLNDEIRWVFSKIEKGDWSYNIDKHYARKETLIFSFMEKY------GITAPPKVMWGVDDSVREMIKEVIVYLKTDKTNPLREMLENLLTEIEEMIFKEEAIMIPMCLDVFSLKDWEQIEEDSKEIG........................... 244
4 -24.100[D] COG2846 Regulator of cell morphogenesis and NO signaling  ali follow..  15  72LAEIIDHIIVRYHELILQATKVERVHADKKYLTMLHEELSSHMMKEEQILFPMIKQG---MGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPMYNGINELIDDLMDHISLENNVLFPRALAG............................................ 219
5 -18.900[K] COG3160 Regulator of sigma D  ali follow..  15SNKLVDXWLHVRKHLLVAYYNLSYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKL--EGNGQLARAAKIWPQLEANTQQIMDYYDAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKH........................................ 156
6 -14.800[P] COG2703 Hemerythrin  ali follow..  16  13....NAKIDEQHKKLFKLAAKVEVVSDRSVSKNEVKELLADHFNDEEKYMYPNLEEH---------------RKIHKEIIQTMINLIKDIKSTNDLK-EKLYIVAKKWLLEHILYEDMKVEKWRSSSLSTDDGGDVSFEAAEDEDNEHPQFYLYTCNCPGKIHDV...... 168
7 -7.870[S] COG3652 Predicted outer membrane protein  ali follow..  10  80VKVFAKQMIDDHGKVNAELRSL---------------------AERKKLEVEDDASLTDKAKATLLDLANNQVAAH---EKAVELFTQAADNLTDPELQAFAKTHLPALKHHLEMARAL.................................................... 183
8 -6.340[S] KOG4367 Predicted Zn-finger protein  ali follow..  11  204........LAKHRLVP-----PAQGRVSRRLSPRKVSTCTDH-ELENHSMY-ALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKE-HEHKLKVVRDQISHCTVK-LRQTTGLMEYCLEVIKENDPSGF. 382
9 -6.290[S] COG3124 Uncharacterized protein conserved in bacteria  ali follow..  1MNFLAHLHLAHLALSGNLLADFVRGNPEESFPPDVVAGIHMHRRIDV--EVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCYAREQVMTILPDSPPRFINDMDFIQNVLNGMASRRPRLDLRDSWYDLDAHYAALETRFWQFYPRMMAQASRKAL. 193
10 -6.280[S] COG2318 Uncharacterized protein conserved in bacteria  ali follow..  11  1MLDHYRMFADYNRRVYAAVSELSDSEYREDKGAFFGSLHGTHILVADRIWMKRFTKEGEAPSRLDAILHEDLNGLTAARVAEDERIIAWIDSLDEERLAGHFTRTLAHFFNHQTHHRGQAHATLTAL............................................ 148

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.