current user: public

If you have questions about the server, please let us know.

Query: [R] COG5614 Bacteriophage head-tail adaptor, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MAISAGRLTQMISVLNPVLTRNAAGEMTEEWVSCGKIHADIRGRSSRERMQSGAEMAQAEIRIWVRGQSGREITAASRLHVLSGPWRDRILNVVGLPVPDVTGGRLEILCRLGGEKLast
1 -79.100[R] COG5614 Bacteriophage head-tail adaptor  ali  100  1MAISAGRLTQMISVLNPVLTRNAAGEMTEEWVSCGKIHADIRGRSSRERMQSGAEMAQAEIRIWVRGQSGREITAASRLHVLSGPWRDRILNVVGLPVPDVTGGRLEILCRLGGEK 116
2 -4.740[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  11  66.....NERQEPVTVHYRFYWYDARGLEMHPLERPRSV--TIPAHSAVTLYGSANFLGAHKVRLYLY.................................................. 124
3 -4.740[P] COG3420 Nitrous oxidase accessory protein  ali follow..  15  50VRLRAGRHEGAVVIDRAIELTGEPGAVLDG-GNAITVNAPNAIVRGLEVHGSGDNLPDLHSGIFVSRTATGARVENNRL..................................... 130
4 -4.590[T] COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1  ali follow..  91LKIKLPLIPADVDKIVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGELYRHNAEWKFRAVGQGYAGGLSSVCA..................... 185
5 -4.550[J] KOG3403 Translation initiation factor 1A (eIF-1A)  ali follow..  11  1MPKNKGKGGKN---RRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARS............ 102
6 -4.300[R] KOG3328 HGG motif-containing thioesterase  ali follow..  10  164VHAEEGNLRVEFEVEKDQTNQFETGGCTAALIDCFTTGALLLTKEAR---------PGVSVDLHITYLTAANIGETLVLNSTVIKQGRSLGFTKAELYRKRDNAMI.......... 262
7 -4.210[S] KOG4781 Uncharacterized conserved protein  ali follow..  131...STRQVYAIAHVGKDVGLDDDHPGLIAT----------MDEVLAICSFLSLPNKIAVTANLKLSNPTKAYTNHFYILRSHLEWTKGRKATAYMLDNEDPSKSTCVAIAD..... 235
8 -4.100[R] COG2389 Uncharacterized metal-binding protein  ali follow..  11  1..MPAGKIHDRITLGATPAVMDIHSCQYKRWGWLRWVWLPYRHFIPHRSPLSHGFLIGTILRL..................................................... 92
9 -3.930[J] COG0721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit  ali follow..  10  2SRISIEEVKHVAHLARLAITEEEAKMFTE---QLDSIISFAEELNEVNTDNVEPTTHVLKMKNVMREDEAGKGLPVEDVMKNAPDHKDGYIRVPSILD.................. 96
10 -3.900[R] COG3489 Predicted periplasmic lipoprotein  ali follow..  11  46LHQHAEALTRAMHTLCKAPSQGELDAARAEFSATVYAWSSAEIIG....................................................................... 90

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.