current user: public

If you have questions about the server, please let us know.

Query: [J] KOG0003 Ubiquitin/60s ribosomal protein L40 fusion, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKKLKLast
1 -74.900[J] KOG0003 Ubiquitin/60s ribosomal protein L40 fusion  ali  100  1MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK 128
2 -56.900[J] KOG0004 Ubiquitin/40S ribosomal protein S27a fusion  ali follow..  60  1MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKRKKVKLAVLKYYKVDENGKILRRECPSDECGAGVFMAS 134
3 -51.600[O] COG5272 Ubiquitin  ali follow..  94  1MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG.................................................... 76
4 -50.800[DO] KOG0005 Ubiquitin-like protein  ali follow..  55  1MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG.................................................... 76
5 -44.100[OR] KOG0001 Ubiquitin and ubiquitin-like proteins  ali follow..  61  1MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQQRLIFAGKQLEDGRTLA 133
6 -39.500[O] KOG3493 Ubiquitin-like protein  ali follow..  25  2IEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYYQ........................................................ 73
7 -36.200[K] KOG4495 RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B  ali follow..  22  1MDVFLVIRRHKTIFTDAKESSTVFELKRVVEGILKRPPDEQRLYKDYQLLDDGKTLGECGFQAPATVGLAFRAHDAFEALCIEPF--------SSPPELLDVMKPQESGSSAN............... 113
8 -33.800[L] KOG0011 Nucleotide excision repair factor NEF2, RAD23 component  ali follow..  31  3VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVT........................................................ 77
9 -28.500[A] KOG0007 Splicing factor 3a, subunit 1  ali follow..  35  697VTIQVLKLNGQMIAVTMALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTVHLQVKERGG.................................................... 781
10 -27.100[L] KOG0012 DNA damage inducible protein  ali follow..  26  1MKITVTTSDDKVFCLDVAQDLELENLKALCAMEIGAEVSQIAVIFNGRELSDKQTLQQCGVGDGDFIMLERRRSA..................................................... 76
11 -25.900[OR] KOG0010 Ubiquitin-like protein  ali follow..  36  37MKVTVKTPKEK-EEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIK........................................................ 107
12 -25.400[O] COG5227 Ubiquitin-like protein (sentrin)  ali follow..  11  36INLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGG.................................................... 111
13 -25.000[O] KOG1769 Ubiquitin-like proteins  ali follow..  15  17INLKVAGQDGSVVQFKIKRHTSLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLRMEDEDTIDVFQQQTGG.................................................... 92
14 -23.300[S] KOG0013 Uncharacterized conserved protein  ali follow..  15  177.....YSKDDKDYSIQINPNLPFSHAKSQLEEV--GLENVQRFFFLGRVLQFKKSLSQQGWTSGMIIQAM.......................................................... 239
15 -23.300[T] KOG4361 BCL2-associated athanogene-like proteins and related BAG family chaperone regulators  ali follow..  10  51IRVRIKY-GAVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKASKAISDISLEVDR....................... 154
16 -22.000[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  33  1MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQR........................................................ 72
17 -17.500[O] KOG4583 Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain)  ali follow..  20  29VRLLIKSSNQQDLNVDSDLCWTVQRLKKHLSLIGKPLIQDQKLIYSGKLLDDSQKISEVVYQQHHIFHLVCA........................................................ 110
18 -17.300[S] KOG2827 Uncharacterized conserved protein  ali follow..  17  94SLDSPLPIEVPARPFPDKPYYWMNDYKTLEFIRTNFPSDSFYVMHNGKIIENFNAFIDENMGQSLKYSFHLRVRGG-FGSLLRSFRVNKSTNKLMMRDLNGR----------RM----ASVDEEAKLK 210
19 -17.000[S] COG5417 Uncharacterized small protein  ali follow..  11  9VTVDFTNWGADKYDLRIPVHQPIKALIINLAETLKIEYKDLKTTNKAILLSDDDKLTNFQIADGDILEIL.......................................................... 83
20 -16.400[T] KOG1363 Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains)  ali follow..  12  103...FRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQSSTIQEVKRNVYDLTSIPVRH............... 234
21 -13.400[Y] COG5100 Nuclear pore protein  ali follow..  20  1MLIRFRSKNG-THRVSCQENDLFGTVIEKLVGNLDPNADVDTFTVCEKP-LADRTVMDLGLKHGDMLIL........................................................... 76
22 -12.600[YU] KOG2834 Nuclear pore complex, rNpl4 component (sc Npl4)  ali follow..  14  5IIIRVQSPDG-VKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNTASSNKSLNLLKIKHGDLLFLF.......................................................... 78
23 -12.100[Y] KOG2086 Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion  ali follow..  19  297TNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILFPNKELADSQTLKEANLLNAVIV............................................................. 367
24 -11.300[D] KOG4842 Protein involved in sister chromatid separation and/or segregation  ali follow..  15  13IRVSL-LWKGNKYSVEIDSGASLKDLGYELRKLTGVTSETLRLIVPRLNEKSSLSLQESNIIEDKTIRMM.......................................................... 93
25 -11.100[O] KOG2689 Predicted ubiquitin regulatory protein  ali follow..  18  255.RIQVRLQDGSTLQETFNVKEQLSAVRVFIQMKTGIESPFSLMTFPRKLFDYEKPLEVLGLVPSAVITMT.......................................................... 327
26 -10.700[R] KOG2507 Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains  ali follow..  10  402.RLQIRLPGGIQRTKSFPAGEVLATVRVYVRNEAASDVRDFTLAYPRREFDEVKTLNELNLVPNAVVLVL.......................................................... 477
27 -10.600[TO] KOG3288 OTU-like cysteine protease  ali follow..  21  5FSVKLKSKKGQFIVNDLNEHTTLGELKTKIVQATDIEATQLHVLVG-SQQQEQRALKAVGINSGETLIV........................................................... 80
28 -10.100[O] KOG1364 Predicted ubiquitin regulatory protein, contains UAS and UBX domains  ali follow..  17  354TRIQIRMPNGARFIRRFSLTDPVSKVYAYVKGV-AEGADKQPFSFQRKSLWTDSTIKEAGIQNTALQ............................................................. 423

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.