current user: public

If you have questions about the server, please let us know.

Query: [J] KOG0004 Ubiquitin/40S ribosomal protein S27a fusion, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDKLast
1 -88.200[J] KOG0004 Ubiquitin/40S ribosomal protein S27a fusion  ali  100  1MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK 156
2 -56.900[J] KOG0003 Ubiquitin/60s ribosomal protein L40 fusion  ali follow..  60  1MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKY----NCDKSVCRKCYARLPPRATNC--RKRKCGHTNQLRPKKKLK...................... 128
3 -52.700[O] COG5272 Ubiquitin  ali follow..  98  1MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG................................................................................ 76
4 -52.200[DO] KOG0005 Ubiquitin-like protein  ali follow..  57  1MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGG............................................................................... 77
5 -48.300[OR] KOG0001 Ubiquitin and ubiquitin-like proteins  ali follow..  52  1MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM-QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG.... 151
6 -39.900[O] KOG3493 Ubiquitin-like protein  ali follow..  26  2IEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYYQ.................................................................................... 73
7 -38.300[K] KOG4495 RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B  ali follow..  21  1MDVFLVIRRHKTIFTDAKESSTVFELKRVVEGILKRPPDEQRLYKDYQLLDDGKTLGECGFQAPATVGLAFRAHDAFE------------ALCIEPFSSPPELLDVMKPQESGSSANEQAV................................... 117
8 -36.600[L] KOG0011 Nucleotide excision repair factor NEF2, RAD23 component  ali follow..  25  3VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFP......................................................... 104
9 -31.200[A] KOG0007 Splicing factor 3a, subunit 1  ali follow..  36  697VTIQVLKLNGQMIAVTMALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTVHLQVKERGGRKK............................................................................. 784
10 -28.300[OR] KOG0010 Ubiquitin-like protein  ali follow..  36  37MKVTVKTPKEK-EEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIK.................................................................................... 107
11 -26.600[L] KOG0012 DNA damage inducible protein  ali follow..  28  1MKITVTTSDDKVFCLDVAQDLELENLKALCAMEIGAEVSQIAVIFNGRELSDKQTLQQCGVGDGDFIMLERRRSAN................................................................................ 77
12 -25.800[O] COG5227 Ubiquitin-like protein (sentrin)  ali follow..  11  36INLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGG................................................................................ 111
13 -25.400[O] KOG1769 Ubiquitin-like proteins  ali follow..  15  17INLKVAGQDGSVVQFKIKRHTSLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLRMEDEDTIDVFQQQTGGV............................................................................... 93
14 -24.500[T] KOG4361 BCL2-associated athanogene-like proteins and related BAG family chaperone regulators  ali follow..  15  51IRVRIKY-GAVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLI...................................................................................... 119
15 -24.000[S] KOG0013 Uncharacterized conserved protein  ali follow..  17  177.....YSKDDKDYSIQINPNLPFSHAKSQLE--EVGLENVQRFFFLGRVLQFKKSLSQQGWTSGMIIQAM...................................................................................... 239
16 -23.500[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  21  1MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSV............................................. 111
17 -20.200[T] KOG1363 Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains)  ali follow..  14  103...FRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKWKTGDVEDSTVLKSLHLPKNNSLYVLTSLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQL..................................... 236
18 -19.200[O] KOG4583 Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain)  ali follow..  20  29VRLLIKSSNQQDLNVDSDLCWTVQRLKKHLSLI---LIQDQKLIYSGKLLDDSQKISEVVYQQHHIFHLVCA.................................................................................... 110
19 -17.300[S] COG5417 Uncharacterized small protein  ali follow..  11  9VTVDFTNWGADKYDLRIPVHQPIKALIINLAETLKIEYKDLKTTNKAILLSDDDKLTNFQIADGDILEIL...................................................................................... 83
20 -15.900[S] KOG2827 Uncharacterized conserved protein  ali follow..  18  94SLDSPLPIEVPARPFPDKPYYWMNDYKTLEFIRTNFPSDSFYVMHNGKIIENFNAFIDENMGQSLKYSFHLRVRGG................................................................................ 170
21 -13.700[YU] KOG2834 Nuclear pore complex, rNpl4 component (sc Npl4)  ali follow..  15  5IIIRVQSPDG-VKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNTASSNKSLNLLKIKHGDLLFLFPS-SLAGPSSEMETSVPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRD..................................... 126
22 -12.900[Y] COG5100 Nuclear pore protein  ali follow..  14  1MLIRFRSKNG-THRVSCQENDLFGTVIEKLVGNLDPNADVDTFTVCEKP-LADRTVMDLGLKHGDMLILNYSDKPANEKDGVNVEIGSVGIDSKGIRQHRYGPLRIKELAVDEELEKE...................................... 125
23 -12.200[J] COG1998 Ribosomal protein S27AE  ali follow..  37  2.....................................................................................................QKRELYEIADGKLVRKHRFCP--RCGPGVFLAEHADRFTCGRCGYTEFKKVKKAK 54
24 -11.800[D] KOG4842 Protein involved in sister chromatid separation and/or segregation  ali follow..  14  13IRVSL-LWKGNKYSVEIDSGASLKDLGYELRKLTGVTSETLRLIVPRLNEKSSLSLQESNIIEDKTIRMM...................................................................................... 93
25 -11.200[Y] KOG2086 Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion  ali follow..  19  297TNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILFPNKELADSQTLKEANLLNAVIV......................................................................................... 367
26 -10.900[O] KOG2689 Predicted ubiquitin regulatory protein  ali follow..  18  255.RIQVRLQDGSTLQETFNVKEQLSAVRVFIQMKTG-IESPFSLMFPRKLFDYEKPLEVLGLVPSAVITMT...................................................................................... 327
27 -10.900[R] KOG2507 Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains  ali follow..  10  402.RLQIRLPGGIQRTKSFPAGEVLATVRVYVRNEAASDVRDFTLAYPRREFDEVKTLNELNLVPNAVVLVL...................................................................................... 477
28 -10.200[TO] KOG3288 OTU-like cysteine protease  ali follow..  21  5FSVKLKSKKGQFIVNDLNEHTTLGELKTKIVQATDIEATQLHVLVG-SQQQEQRALKAVGINSGETLIV....................................................................................... 80
29 -9.590[OT] KOG2561 Adaptor protein NUB1, contains UBA domain  ali follow..  99..........QMLEIKCSLGGLGSDLQAEVAKKLDIVDSSHKCISGGRIINGQKTLASQGLKTNQHLMVVVGGTNEGQELHERIQRIRADLELVADADRFMEMEDQDGRPIFLPREENRSLLMAMSMYEVARVAMHKENFDEALLILLEADE.... 241
30 -9.210[O] KOG1364 Predicted ubiquitin regulatory protein, contains UAS and UBX domains  ali follow..  19  354TRIQIRMPNGARFIRRFSLTDPVSKVYAYVKGV-AEGADKQPFSFQRKSLWTDSTIKEAGIQNTALQ......................................................................................... 423

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.