current user: public

If you have questions about the server, please let us know.

Query: [L] KOG0011 Nucleotide excision repair factor NEF2, RAD23 component, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# Score Template Links and tools%idFirst MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDELast
1 -122.000[L] KOG0011 Nucleotide excision repair factor NEF2, RAD23 component  ali  100  1MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE 363
2 -46.300[OR] KOG0010 Ubiquitin-like protein  ali follow..  16  36.IMKVTVKTPKEK-EEFAVPENSSVQQFKEEISKRFK---SHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEQLIMANPQMQQLIQRNPEIS-NNPDIMRQTLELARNPAMMQEMMRNAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNNPLSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGAGVNPQLQNPEVRFQQQLEQLSAMGFNREANLQALIATGGDINAAIERLLGS..... 586
3 -39.000[L] KOG0012 DNA damage inducible protein  ali follow..  13  1..MKITVTTSDDKVFCLDVAQDLELENLKALCAMEIG---AEVSQIAVIFNGRELSSDQTLQQCGVGDGDFIMLERRRSANRPVGGNPAISTLDFSNIAVPGTSSGGSPPSRRVQQQGVQQPQFNNLTDIPTTDEFNVNFDDDPEERKRRNEHRMRMLNADPFDEETQRLIAEEIKQKNIQDNMAAAIEYNPEIINCKVNGIPVKAFVDSGAQTTIMSKDCAER---GQQPMDMLLGLDMLKRHQCLIDLQRNLL--IIGTTGTTTPFLPE-LPVSARLTGNSEDSMEQEAISNAIEQSKRESGGAGGGPNTISPQERFTEQDVTDLMALGYPRSDVLTVLRLCGGNKQAARSVLLHRNDAAS 453
4 -36.500[J] KOG0004 Ubiquitin/40S ribosomal protein S27a fusion  ali follow..  25  1..MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVK................................................................................................................................................................................................................................................................... 99
5 -33.800[J] KOG0003 Ubiquitin/60s ribosomal protein L40 fusion  ali follow..  31  1..MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR.............................................................................................................................................................................................................................................................................................. 72
6 -33.200[DO] KOG0005 Ubiquitin-like protein  ali follow..  30  1..MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEG---IPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGG........................................................................................................................................................................................................................................................................................ 78
7 -32.400[O] COG5272 Ubiquitin  ali follow..  31  1..MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR.............................................................................................................................................................................................................................................................................................. 72
8 -27.800[O] KOG3493 Ubiquitin-like protein  ali follow..  22  2..IEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTG---TKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYYQ.............................................................................................................................................................................................................................................................................................. 73
9 -25.600[O] KOG4583 Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain)  ali follow..  16  28.SVRLLIKSSNQQDLNVDSDLCWTVQRLKKHLSLIYPGK--LIQDQKLIYSGKLLDDSQKISEVVYQQHHIFHLVCASKQVIRPAAKAPTVPQKDAVPAGPEVTGNANELRQRHAPHQQQAQQGNAGPHVTGDIGLAN................................................................................................................................................................................................................................. 171
10 -25.000[OT] KOG2561 Adaptor protein NUB1, contains UBA domain  ali follow..  14  85...TFNVRCVTVQMLEIKCSLGGLGSDLQAEVAKKLDIVD--SSHVKCISGGRIINGQKTLASQGLKTNQHLMVVVGGTNEGQELHERIQRIRADLELVADADRFMEMEDQDGRPIFLPREENRSLLMAMSMYEVARVAQNRRDEAYEKLEVATKDLYEVKMNDTELSTLVEMGYEESDARLALRSCAGQVDRAIQYIQERSERISEERKNSAAERQVNQEMIFAGQGGEWVN-------------------PRSIIRLMEMGYERRLVVEALKRTKNNLDRSLD-----------------QRHSDELRANLPPIPPVDESLLTTLQHLGFSEISARDALETTGNSFHKSLKFLLKSFPNES 519
11 -24.500[OR] KOG0001 Ubiquitin and ubiquitin-like proteins  ali follow..  25  1..MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT.................................................................................................................................................................................................................................................................... 98
12 -24.100[K] KOG4495 RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B  ali follow..  15  1..MDVFLVIRRHKTIFTDAKESSTVFELKRVVEGILK---RPPDEQRLYKDYQLLDDGKTLGECGFTSQATVGLAFRAHDAFEALCIEPFSSPPELLDVMKPQESGSSANEQ........................................................................................................................................................................................................................................................... 115
13 -22.900[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  18  1..MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQG---VPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA.............................................................................................................................................................................................................................................. 120
14 -21.700[T] KOG4361 BCL2-associated athanogene-like proteins and related BAG family chaperone regulators  ali follow..  14  50.MIRVRIKY-GAVYHEINISPQASFGELKKMLTGPTG---IHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKASKA....................................................................................................................................................................................................................................................................... 144
15 -21.200[S] KOG0013 Uncharacterized conserved protein  ali follow..  12  170.LETVLIRSKDDKDYSIQINPNLPFSHAKSQLEEVG-----LENVQRFFFLGRVLQFKKSLSQQGWTSGMIIQAM................................................................................................................................................................................................................................................................................................ 239
16 -20.400[A] KOG0007 Splicing factor 3a, subunit 1  ali follow..  22  697VTIQVLVWKLNGQMIAVTMALSEPIANLKTKLQDETG---MPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTVHLQVKERGGRKK....................................................................................................................................................................................................................................................................................... 784
17 -17.200[S] COG5417 Uncharacterized small protein  ali follow..  16  7MNVTVDFTNWGADKYDLRIPVHQPIKALIINLAETLKYKDLSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL................................................................................................................................................................................................................................................................................................ 83
18 -16.700[O] COG5227 Ubiquitin-like protein (sentrin)  ali follow..  36..INLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQG---KSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGGC......................................................................................................................................................................................................................................................................................... 112
19 -16.700[O] KOG1769 Ubiquitin-like proteins  ali follow..  17..INLKVAGQDGSVVQFKIKRHTSLSKLMKAYCERQG---LSMRQIRFRFDGQPINETDTPAQLRMEDEDTIDVFQQQTGGVPESSLAGHS................................................................................................................................................................................................................................................................................ 102
20 -14.500[S] KOG2827 Uncharacterized conserved protein  ali follow..  94..SLDSPLPIEVPARPFPDKPYYWMNDYKTLEFIRTN---FPSDSFYVMHNGKIIENFNAFIDENMGQSLVKYSFHLRVRGGKSLLRSFRVNKSTNKLMMRDLNGRRMASVDEEAKLKRYLEKQARKEQELKEKRKAKLEKLTAGPAKHMFEDQDYLSRREEIINKTEDACEAGFALMLEMKRNSRKSKEQENKNDEDEDDDVNAEDVTDLFNDRGGRKRKIAAPSIGEDGGNKRINDESDDSEDDSENEVDPEELEAIRQYFEAKKQDEKDNGEGTSEAVPEVLVDEQEIEPAKRPRLDSASNIDDLPKIDVKTPCEYGPTSAEDLELLGLEHKSALNDRLKCGGSLVERAARLWC...... 457
21 -14.300[S] KOG2632 Rhomboid family proteins  ali follow..  20  336............................................................................................................................................................................................................................................................................................PDRLSDATVNTVADSRQAPIANAAVLPQSQGRVAASEEQIQKLVAMGFDRTQVEVALAAADDDLTVAVEILMSQQ.... 410
22 -12.800[YU] KOG2834 Nuclear pore complex, rNpl4 component (sc Npl4)  ali follow..  12  1MAIIIRVQSPDG-VKRITATKRETAATFLKKVAKEFG---FQNNGFSVYINRNTASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDP............................................................................................................................................................................................................................................... 127
23 -12.400[S] KOG4463 Uncharacterized conserved protein  ali follow..  10  221.................................................................................................................................................................................................................SDMQNASTFNPETLFALPTGLDAERTENENQVENPVSNADANDSPTRQNARATAIASSSNTAASFRNRQQISHPPLGRTSSSSVLPTGPASQLYDMLSGRSERPELGNIREEDINTVQTIMQTSRAQAIQA-LSQTNDVQRAVELLLEQTAD.. 371
24 -11.500[T] KOG1363 Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains)  ali follow..  14  106........EYRDRNVDVVLEDTCTVGEIKQILENELQ---IPVSKMLLKWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQN......................................................................................................................................................................................................................................................................... 193
25 -11.400[Y] COG5100 Nuclear pore protein  ali follow..  1..MLIRFRSKNG-THRVSCQENDLFGTVIEKLVGNLD---PNADVDTFTVCEK--LADRTVMDLGLKHGDMLILNYSDKPANEKDGVNVEIGSVGIDSKGIRQHRYGPLRIKELAVDEE.................................................................................................................................................................................................................................................... 121
26 -10.300[TO] KOG3288 OTU-like cysteine protease  ali follow..  12  1MTFSVKLKSKKGQFIVNDLNEHTTLGELKTKIVQATD---IEATQLHV-YPPKPLDEQRALKAVGINSGETLIVEEKAAPAPAAPVPGGTTVEDDEALARRLQAEEEAQLLQETAGGPVAQAADYQLPVAPTE...................................................................................................................................................................................................................................... 139
27 -9.770[D] KOG4842 Protein involved in sister chromatid separation and/or segregation  ali follow..  12.KIRVSL-LWKGNKYSVEIDSGASLKDLGYELRKLTG---VTSETLRLIVPRLNEKSSLSLQESNIIEDKTIRMMGVSEEEVEGVLKEAVSDMRILGFEEEERRLKQKKSYVSSASIKLPQGTYI.............................................................................................................................................................................................................................................. 143
28 -9.630[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  15  1MSSTIFYRFKSQRNTRILFDTGLTVFDLKREIIQENKLGD--TDFQLKIYTEEEYDDDAFV----IPRSTSVIVKRSPAIKSFSVHSRLKGNVGAAALGNATRYVTGRPRVLQKRQHTATTTANVSGTTEEERIASMFATQENQ........................................................................................................................................................................................................................... 144

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.