current user: public

If you have questions about the server, please let us know.

Query: [B] KOG0273 Beta-transducin family (WD-40 repeat) protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520
# Score Template Links and tools%idFirst MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISINKDGTVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKNREATVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDHPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSYQGTGGIFEVCWNARGDKVGASASDGSVCVLDLLast
1 -118.000[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali  100  1MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISINKDGTVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKNREATVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDHPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSYQGTGGIFEVCWNARGDKVGASASDGSVCVLDL 522
2 -76.800[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  21  2.................TESPQISVSFVSEDENELGGSGILVPVDISTN--------------------------------ELQILCNQLLGSSDDPVPISFFTTEGAEIVDSIRKSLEE--------------------------IDFETTLKLVYQPQAVFRVRPVTRCSASIPGHGEPVISAQFSPDGRGLASGSGDQTMRIWDIELEL--------------PLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTQIGKTLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQGTVVRCLSGHTASVTCLRWGGEGLIYSGSQDRTVKMWRADDGVMCRNMTGHAHWINTLALNTDGERLVSGSDDFTLFMWNPETKQSINRMTGHMQLVNQVVFSPDTR---------YIASASFDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPGHGDVFTVDWSPEGTKVVSGGKDKVLKLWR. 472
3 -76.600[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  134........PFVLRRRFLGGFDDVTWLDWSSDSRLLAIGCRDSSTKIVAILSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSLAPSDLEDAERPKIAPPQRKKEKKAVSDNESEDDVENVVEKDALKE-----ESTKEAEDVNHIKNEDETKSHPFFYKKITRHYLADE-PRKEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVN--------------MIHSLSISDYPISAALFNCTGDWVALASREGQLLVWEQSEQYIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNKKLVSSSLDGTVRAFDVNRYRNFRTFSPNPAQFSCVAVDYSGELVVAGGQDFDIFLWSVKTGKLLEIISGHEGPVVSIAFSPVA-------TSSTLVSGSWDKTVKIWNCLESNSEHETIDAVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTTIEGRNYFSTIEYSADGECILAAGKSANICIYHV 656
4 -76.500[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  80LAVGYEDGSIRIFSLFNGHKAAITTLKYDQLGGRLASGSKDTDIIVWDVLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLTQHCFKTMVGHRTEVWGLVLLSEEKRLITGASDSELRVWDIAYLQEIEDPEEPDKGSSPGIQDTLEAEDGAFETDEAPEDRILSCRKAGSIMREGRDRVVNLAVDKTGRILACHGTDSVLELFCILSKKEIQKKMDKKMKVRTSRITIGGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRTLQCIRTMTCEY--ALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLETIDAHDGALWSMSLSPDQRFVTGGADKSVKFWDFELVKDENSTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGA---------LIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHQEIWCLAVSPSGDYVVSSSHDKSLRLWER 704
5 -74.700[R] KOG0286 G-protein beta subunit  ali follow..  17  1....................................................................................................................................................................MGEMEQLRQEAEQLKKQIADARKACADVTLAEL--VSGLEVVGRVQM--------------RTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGE---------AICTGSDDASCRLFDLRADQELICFSHESCGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNVSCLGVTADGMAVATGSWDSFLKIWN. 340
6 -74.300[S] KOG0295 WD40 repeat-containing protein  ali follow..  20  20..........................................................................................................................................QNNGYSESFSVFLKESSLSENDIKPLGGIWTTVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAADWIPRPP--------------ETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFQTYDCLKSLKGHEHTVSSVTFLPTGDVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPDTAQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHVSTVAFHQTSPFVITGSVDMSCKVWEC 403
7 -74.100[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  15  150LHFSRITFDLLL-HFLFENVSNGGSIIIKLINQHIDIHIVPGR----TVLENAKVINEQEGITGQSFERGDAQLQPVKLQQMPMDKEMEKIVEMDLEEEDMMHQNDPNNQSPKLLKEFRKLHEPNAE----DAPSRDYIPLPPHKGVDILSEVEAVKDWSKRLHLSLPSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKSTSVE-DSDGSVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVTKTALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSAVLTGSSDKTCRLWDVHRGHSVRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTMRGHRGNIYSLSFSREST---------VLVSGGSDCTVRAWDVFKTNYNNPVSSSLTGSVVTPFSAKTSTFNE--------VNWSTSPDQMVALYTKTPIFNVSFTRRNLCLAISVS......... 643
8 -73.500[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  14  206...............VNGTEAEVKETAMIAKSELTDSASVLDNFKFLES-DDVDGREKSVIDTSTIVRKKALPDSGEDRDTKEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLMPEAWNVDQGVITKLKEQYKKERKSKLQDMLANLRDVDELPSLQPSVGSPSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGPGELAIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNLRGPLLGHTDAVWGLAYSAAHQLLSCSADGTLRLWNTTEVAPALSVKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLENSSCQINRVISHPTLS---------ISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHESIHDVAFHPSKCYIASAGADALAKVF.. 779
9 -72.600[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  14  75LLVAYNNQIIREYSWKTIHTAPILVMEFNEEGHLLATGSADHIVKVWNLTE--PSVVSAILFGKHEKLVVGYIEGQLN---GAPKKLVNTWKSHNSHITALLQVPDSRVVVALSRDQTMSIHETETQET-----LRVLPLYESIEGGAIGHNGN-LFTVGEEGVVKEFAKLVRKKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQIVG-------------FHDEIYSCCLLGKDESHMAVASNTSEIRLYNTTLDCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLSTLVPVAAATGHANTVTALAISNTGRLASVSTDCTIKLWGLGKLTCSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKIAGTLSGHRRGVGDVKFAKNSH---------KLASCSGDMTIKIWNISEKSCLQTISGHSCAVFRVIFARNDSQLISADSAGIIKIWTIKTADCECSIDAHDKIWSLSKNHNESEFVTAGTDGRIVVWK. 635
10 -71.300[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  20  8........................................................................................................................................................................NSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQA-------------------PIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQLCSGSDDRTIKIWDARKKHAAHTLESP-FQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGD---------FILTNAMDNTLRVWDVRGERCVKVFQGHQHNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHGSVNAVDFSPKEPLILSGSSDKTLYLGEI 345
11 -71.100[S] KOG0282 mRNA splicing factor  ali follow..  15  109.............NMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSL-------------------------DNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDE-----KDVAKPSEEEQKELDEITAKRQKKGKQEEEKEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPK---------------KQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKV-PYCVKFNPDEDFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIEPSMHSMPAVTLSPNGK---------WLACQSMDNQILIFGAQNRFRLNKKKMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKCIGAVWHPETSKVITCGWDGLIKLWD. 579
12 -71.100[A] KOG0285 Pleiotropic regulator 1  ali follow..  14  6.....REVETQSLKKLSLKSVRRAREIFSPVHGQFPQPDPESKRIRLCHKIQVAFGGVEPASKPT------------------RIADHNSEKTAPLKALALPGPKGSKELRKSATEKALVVGPTLPPRDL-----NNTGNPGKSTAILPAPGSFSSTAALMERMPSRWWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGV--------------LKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLQNKVIRSYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVL-PHDSDVFSVLARPTDPVITGSHDSTIKFWDLRYGKSMATITNHKKTVRAMALHPKENDFVSASADNIKKFSLPKGEFCHNMLSLQRDIINAVAVNEDG----------VMVTGGDKGGLWFWDWKSGHNFQRAETSEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDEDA-------TPETHPLNFKPPKEIRR............. 476
13 -70.800[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  13  193LALGGLDNKIKLYSGLKGHTDWIRSLDFSLPLHMLVSSSQDKVIRIWKLVLVGDVGSWRREITLASYIEGPVFVSGTF---TYQISVESVLIGHEDWVYSVEWQPPVIDILSASMDKTMMIWRPEKKTVNVVCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDEGNEAEDEHWHELA-RPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPSSEPLERNGGGEGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNELFSLCSDHKGNLVASSCKAEIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQRTKLMAKVEAHKRIIWACSWNPFGH---------QFATSSRDKTVKIWSVENDAQILVLPPFGSSVTAVAWTGKSGCVAVGMESGLIELSNVKIIERLEPFMCHVSVNRLAWRPTEKWLTSCGDDNCVRVFNF 838
14 -68.500[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  13  39..LYTNGNSVIIRDVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTLKNEFQPIAGPIKDISWSPDNQRIVAVGEGRERFTGTSVGEISGQSKSINSADFRPARPRIVTGSEDNTIAVFEGPPFKFKMT-----QDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTEFGSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEFVM-VADPSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSGTNDRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYVVKLNCQPRGLAILRNENIALACIKELTLVQDQKKIFSL----PIKYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGVLEKVELDHLGAVTDVSYSPDLK---------YLVACDAHRKVVLYSVEEYKPAHNWGFHSARVNTVAWSPNSLLVASGSLDTTIIIWSVANPAKHTIIAHPQSQITRLVWLDNNTVISTGQDCNTKVWHV 605
15 -68.400[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  13  273...............IDKNRLLKKDASSSPASTASSASSTSLKSKEMSLASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSP----QMSAAAAAAAVVAYGRSPMVGFDPPPHMRTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHA--------------RQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLATPRIKAELTSSAPACYALAISPDSKCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQH-DFTSQIFSLGYCPTGE---------WLAVGMESSNVEVLHVNKPD-KYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV 768
16 -68.200[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  16  1...........................................................................................................................................................MSSCVNTSQTGPKKKRDEHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPHHKDAFSARGGVRSPVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIEHGFIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANKTVNNLIGCKDSIYSLATTPNLSVLGAGTEKCIRLFDPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATCIAHEEGVWTLQVDSSFT---------TVYSAGKDKMVVKTPLYDFTKSQLLFKEEAPVKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQLSIGGDEDGIKKHAMLSDKRHVLTRDSDGNVALYDV 420
17 -67.700[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  20  1....................................................................................................................................................................MPLRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFE--------------VTELPVRSAKFVARKQWVVAGADDMYIRVYNNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGACTQIFEGHSHYVMQVTFNPKDTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELP---------IIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLGREIPVASMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGE. 340
18 -67.400[S] KOG0293 WD40 repeat-containing protein  ali follow..  15  62.VIRKSEFVRIITRALYSLGYDKTGAMLEEESGISLHNSTIKLFLQQVKLEFLKVEKIADALRTLRNEAPLRINTKRVHELASSLISPSSFISHTTSTPGKESVNSRSKVLEELQTLLPASVIIPEKRLEC---LVENSLHIQRDSCVFHNTLDSDLSLYSDHQCQIPSQTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHI-----------SLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVSGDCVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKLVSVCKDSVISLFDREATV--ERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKISRYKGHKRSIRSCFGGYKQA---------FIASGSEDSQVYIWHRSTGKLIVELPGHAGAVNCVSWSPTNLMLASASDDGTIRIWGLDRINQQNQKKQGSSSNGVIHRCNGN................ 589
19 -67.300[S] KOG1407 WD40 repeat protein  ali follow..  26  3.................................................................................................................................................................ETTIPFKSLHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHG----------HSKAKDLELKGHTDSVDQLCWDPKHSLVATASGDKSVRLWDARSGKCTQQVELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRR------------------------------------------KFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTAGCYCIAIDPKGR---------YFAVGSADSLVSLWDISDMLCLRTFTKLEWPVRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNPKYNT. 302
20 -67.300[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  20  23................................................................................................................................................DNDKLMDQGVTEDEAEQEQNDTMNDMSVQGFFEHKDSVFSVSINPVHNLCASGGGDDLGYIWDITTGE--------------QICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSTGFEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMYGHTAPVNAGKFIPPGVLATVDDSGTLIVWNPATGAPECRMSETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILASLEAQTESVEAIALCTALP---------ICACASVDGTVALYDSASLKFRKSL-PHEQAVIDCKFLPNTPYLLTACADCVIRKWDVRSGQLLGEYTGHEPILCMAITPDGKRVVTGSDDTELLVFDC 397
21 -67.100[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  16  5.....................................................................................................................................................................ELPTKEAHILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRGI--------------LIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVTGRVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTIIGGSVDGTVRTFDMRIGREMSDNLGQP--VNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGHISKKTDCCLTNSDA---------HVIGGSEDGLVFFWDLVDAKVLSKFRAHDL-VNSIDVDFYLRKFFVAGDKRELPPEGRLYVDFFGRWYNSEKMKKQQILTSIDFVIYVSNSPFFFYYRL 343
22 -66.400[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  1.........................MEISSEDNNLMEKVLPPVEQVLTWTL---------------------------------IQICMQESDVELETKVKKYLRGEGANLETLKDKKLKTQLASREKLYGK----SAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLI---------------KEIQVRETVRDVAFLHNDQFFAAAQKKYAY-IYGRDGTELHCL-KERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMVASIRTGKGRTDVMEVNPYNSVGLGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTI--HSFHAKTLSFSQKG-----------LLAAGTGSFVQILGDSSGGSSHNSMVKGYQIEKVMFRPYEDVIGIGHSMGWSSILIPGSGEPNFDSWVANPFETSKQRREKESLLDKLPPETIMLDPS 452
23 -66.000[R] KOG0288 WD40 repeat protein TipD  ali follow..  16  1MSVGTEKAMEAINDALRALEEGAHAPAISALSKPLISQGSEWKEKTEKLETELQQCYKAQSRLSEQLVIEVAESRTSKAILQEKELLINDLQKELTQRREDCTRLQEELEEKTKTVDVLIAENLEIRSQLEE-----TSRVQKAETENKMLIDRWMLQKMQDAEREANDLYEEMLAKLKANGLETLARQQVDGIVRRNEDGTDHFVESTIPS-------------TCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTSGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRHTLTGHTDKVCAVDVSKFSSVVSAAYDRTIKLWDLHKGYCTNTV-LFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSSAVTSVSLSRNGN---------RILTSGRDNVHNVFDTRTLEICGTLRASGNRLSRSCISPDDDYVAAGSADGSVHVWSLSKGNIVSILKEQTSILCCSWSGIGKPLASADKNGYVCTWT. 515
24 -65.200[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  15  1..........MNGGMMRGNQMPNVTLTIQPSTSSMQNSQPRIMNNHHHP---------------------------------------HNRFQREHVMPDVMGDGPGRRLRKNVANVRRHVDYVSTVLNHCENRL--QYGKQRILQQPDILYQQYAVPADSTPDVPVDKFIRTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAFNFETILQ--------------AHDSAIRALKWASNEQWLLSADQGGYVKYWQPNNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGIATGSRDTPVKIWDPKSGSCLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHEG--------LFVSGGGDGSIVYWMVDGEKEIGLLHAHDQAIWSMKWHPLGHILATGSNDNNTKFWARNFGLSNTNMIGHDKEREPRMAPPKPSIETQETYRPDTFIPG 469
25 -65.100[R] KOG0645 WD40 repeat protein  ali follow..  22  1...............................................................................................................................................................................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDG-------------FHTRSIRRVAWRPIERVLAVASFDSVVSINEKDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDCLAVLQEHTQDVKVVTWHPTEDLVSGSYDNSICFWRDDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNQTSLPHIHKGAVYTISWMNDAT----------LCSAGGDGKIVVYQREKHDYEQDHAHGVYEINSLEYLRDDR-LLSGGDDGECRVWSFK........................................ 322
26 -65.100[T] KOG0279 G protein beta subunit-like protein  ali follow..  19  1....................................................................................................................................................................MAEGLVLKGTMCAHTDMVTAIATPVDNSVIVTSSRDKSIILWKLTKED---------KSYGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLTGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECTISEADGHKEWVSCVRFSPNTLIVSASWDKTVKVWNLQNCKLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG-SIIHSLCFSPNRY----------WLCAATENSIRIWDLESKSVVEDLKVD---LKAEAEKTDGSTGIGNKT-------------------KVIYCTSLNWSADGNTLFSGYTDGVIRVWGI 323
27 -64.600[R] KOG0289 mRNA splicing factor  ali follow..  16  17VSPVSNHVRRLIEKYIAENG---------------TDPINNQPLSEEQLIDI-------------------------------------KVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFT------------LRQQLQTTRQELSHALYQHDAACRVIARLTKREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKARQVASHVGLHSASIPGILALDLCPDTNKILTGGADKNVVVFDKSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDLLSSSDDQYWAFSDIQTGRVLTKVETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGY---------YLATAADDSSVKLWDLRKLKNFKTLQDNNFEVKSLIFDQSGTYLALGGTD--VQIYICKQWTEILHFTEHSGTTGVAFGHHAKFIASTGMDRSLKFYSL 504
28 -64.500[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  12  220VRLTDEDIALI--KRIVSGRIPNKDH----EEYEPWIEWFTSEVEKMPIKNVPDHKRSFLPSVSEKKRVSRMVHALKMGWMKTTEEVEREKQAKRGPKFYMLWETDTSREHMRRIHDPVSAPKRDGHAESYNPPPEYLFDAKETKEWLKLKDEPHKRKLHFMPQLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNIDAEYLIPKLPSPRD-------LQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTIETDEVVRCVAWCPNPKLSIIAVATGNSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDLATVMPEGANRIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQELVKKLLTNSKWISGMSIHPKGD---------NLLVSTYDKKMLWFDLDSTKPYQTMRLHRNAVRSVAFHLRYPLFASGSDDQAVIVSHGMVYNPLKKLQTHFGVLDVNWHPVQPWVFSTGADSTIRLYT. 784
29 -64.400[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  20  2.............................................................................................................................................................................SLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEES--------------KMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTKKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVICRDGVDMGWSTLGDF-CINEGK---------FIGCSYYRNSVGIWVSDISELEVSEDKNECMVKRFSVLNDQSERMGSGPRGSVSP------------YETREIKNIYVDSTGGNLNVAQNPGSLKATLP 320
30 -64.300[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  10  2..............................DDNTAPKKNSEKKARVFDLQAMFAQTIS-------------------------NAPRTEEPTHVPQSVSVSSKSESGVSSSAVSDDEDDFMPDLPPGFQ------MQQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKACEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSMRYD---------KELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQLNITKGHTATVNCVEFNPLNKEFISCSDDGSLRLWNLDDHKVIKGANGKRVSPQVCTFSPDGKIAAGCDDGSVQAWKYGSQYNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKLVKTGLENAFKSTDCGFSPRAEVVFTGTSS---PNKDTPGTLQFFDPMTFDLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQTMSQRGVMSCVTKMPINGKSANGRVAASGGSLHSYLAKQI 550
31 -64.100[R] KOG1539 WD repeat protein  ali follow..  15  1MGI------FEPFRAIGYITSTVPFSVQRLGTETFVTVSVGKAFQIYNCFLLLKPKLPKKIRALASYRDYTFVAFGNEIAVFRRAHQVATWSKHVAKVDLLLVF--GEHVLSLDVEGNMFIWAFKGIEEHLAGNLQLTGKFTPTSIVHPDTYLNKVLVGSQEGPLQLWKKMLYQFKGWGSSVTSCVSSPALDVVAIGCADGKIHVHNIKLDEEIVTFE-------------HASRGAVTALSFSTDGRLLASGGSFGVISIWNLNKKRLVIRDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNRLLRFRSGHSAPPLCIRFYSNGRILSAGQDRAFRLFSVIQEQQSRELNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYYAHDGEVIGVACDSTNTLMISHRVNGLLATVADDFVIRLYDVVTLKMVREFRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKQIDGVHVDVPITALSLSPNMDVLATAHSDQNVYLWV. 648
32 -64.100[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  12  2..................................................................................KLKLSASRKTRHTEMVCGVGWIGTEA-ILSAADDHVFLLTNTATNESQQPETFFPTSLHIFPRSQTKGGQNDVFAVSTSDGKINILGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRS---------------GMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDG-FGQILFNSSVHDYPITSISWNTDGTLFAVGSHNILRLCD-KSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTNTPTMIEYNERTVNIIVQCEKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGNKHEHDIVELTVNQCGRNVAFRDQIGAVHIAMVKTFGVSQRMVKIGSVEQLVFNDVTNMLCGIS-EGKIAVWPL 532
33 -64.100[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  16  2..........................................................................................................................................................................KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGE--------------RLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCQIDNNEPYMKIPCNDSKITSAVWGPLGEIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTF-RTERPVNSAALSPNYDHVVLGGGQEAMSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA.............................. 325
34 -64.000[R] KOG2394 WD40 protein DMR-N9  ali follow..  11  18.............PAANPQSPGIKTYFKTPEGKYKLHYEKTHSSGLLHYAHGKTVTQVTIAQL-----------------------------KERAAPSTPTGTSSGYSASSGFRSATARLLGTGNGSRALSGSFAASNSNTSMTNTNFDGKGTYLVFNVSDAIFSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQDVSKKLVGALHYNKDGSVNNRQDRCTSISWVPSTFPAIRDPTQFSVDKAKSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGALLCCSWSMDGKILTGGEDDLVQVWSMEDRKVVAWGEGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDEIVVPLRRAPGGSPTYSTGSSAHWDNV------IPMGTLQPAPCKRDVPKLSPIIAHRVHTEPLSGLMFTQES--VVTACREGHIKIWTRPSESETQTNSPTTALLSTSFTKDNKASLSSKIISGSTFKQ. 556
35 -63.900[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  15  3.....................................................................................................................................................DQQQLILATGGYDHTIKVWQAHTTMRFVETSQVNALDRTPDKTRLAACGYQ-CIRLYDLESNC------------TAPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRLAAANNKGNCYIWSLTSQRPNRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIENYWVWDAAFSADSK---------WLFTASSDGIARLWKLQTKSSIRDYTGHTKAITALSFKDEIPVKSTNISDVQSSAKPPTQRD-----NPPGTNNLAFFETVGRVAMNPYMGNTTTELN. 362
36 -63.800[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  12  149..VYFIASVVVLYRHYAGHNDDVKCLAVHPDRITIATGQVAGTVRIWDSVTLFDRAVTCIAFSKSNGGTDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRSKDYSRTRKAKVVLCVTFSENGDTITGDSSGNILVWGISYAVQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQK--------------LRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWD-KIIEDPAQSSGFHPSGSVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRVGKCSGHSSFITHLDWSVNSQ---------FLVSNSGDYEILYWVPSACKQVVSVESDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHHSSHVTNVDFLCEDSHLISGGKDTSIMQWRV 716
37 -63.800[T] KOG4378 Nuclear protein COP1  ali follow..  18  1.....................................................................................................................................................................................MMSNLVEPSWRLLAASGGD-TVKLFDVSADSGDPCV----------LSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVDSAEECLSAISFSKKGSYICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDELASVSVGGDLIVHNLASGARATELKDPNGQLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRSPKMSLKQHSAPTAGVCFSPSNE--------KIIASVGMDKKLYTYDSGSRRSSSCI-AYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPVLHAFSNSEDVTSLSWQTSKPVIVNEKNYTSEMAL.. 342
38 -62.400[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  15  2........................................................................................................RDEILDPSNLVKNREILYRLMISQLMYD------GLEKFAMELSMLVKADQCAPSERLLHVMIASDKDKTNSDDVLPGIDLEFEPEASALAPEPHSYETAY-------------------------VTSHKQACRAGAFSCDGSLVATGSVDASIKILDVEHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKKVFTDCEPVLCLSFHPTGDVAIGTEHNVLRVYDVATTQCFVSAQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGAICSLEFTRNGK---------YLLSSGMDSLVYLWELCTSRPIQTYTGQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCRLTLNGHNGPVRYITHSPNGPAFLTCSDDFRARFWYR 419
39 -61.900[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  15  2.............................SDDDDIQYIKRQRTLHYGSLEESERKRQNAAASGAAATTTSGTTASSGAGTTTTLEDIDSDEDYEESTKKTSNAKQAGAPPPTAATLANKIDDDYFDLEMEME-----RDKVALLEEFERKKRARQINVSTDDTEIKSNRRRLKELLAGLGENAINKRQYEDEERKQQQREQDQATWYHEGPDSLRIARLWLAQSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVDCELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIADITGHPHRVSKVAFHPSGRLATACYDSSWRLWDLEQKTEVLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDFSPNGF---------HIATGSQDNTCKIWDLRRRQPVYTIPAHTNLISDVKYQQEGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNVISVDIAPNSQYIATTSFDRTFKLWSP 551
40 -61.400[R] KOG2096 WD40 repeat protein  ali follow..  12  2........................DSVLVVGIASVILGALIAVLFFGSYFR---------------------------------KRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQNKRHH-------------------------------------PLDLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSF----------------NRWEFTLQAHFHDLTVFFVCFLKFRFLRIFADDASSIVVACHHMSGSSLYMYGEDKQKDQQGKLPLPSIKWDHHHIHEKRSVLTISGATATYGTADGSVIASCSEGTDIVLWHGKTGRNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKRVMQLKGHKSAVTWLCFSPNSE---------QIITASKDGSIRVWNINVRYPLCDSGGNPLHYDRLSLCPEGKILAASH-GSTLQWLCAETGNVLDTAEHEGDITCISWAPKAMVLGTSGDDKKVKLWEA 448
41 -60.500[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  14  1...........................................................................................................................................................................MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQ-------------VKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENSKHIKKPIRSTVLSLDWHPNNVLAAGSCDFKCRVFSAYIKESEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENS----------VVAAGHDCCPMLFIYDDRGCLTFVSKLDIPKQSIQRNMSAMERFRNMDK-----RATTEDRNTALETLHNSITQVSIKQDCRKFCTTGIDGAMTIWDF 357
42 -60.300[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  20  5.......................................................................................................................................................................CGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDEAG-------------LRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAAGPLQVYKEHAQEVYSVDWSQTRGLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRNRQPVFELLGHTYAIRRVKFSPF--------HASVLASCSYDFTVRFWNFSKPSLLETVEHHTEFTCGLDFSLQSPQVADCSWDETIKIYDPACLTIPA.................................. 323
43 -60.100[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  14  2........................................................................................................................................................AAIINQRVEQGESSMGPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPS------------IHHFMPVAPTSLYYSEETYKLLVGLINGNVYEFSVSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSN---KMGSYLLENSCTAMVIDLPVFVGDHGGHVTVLRIVDNQLVSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGRGEYELNGHNGKVTTLCAAPAAK---------RLFSADEHGKLMCWDMNCKRVETPEWKTSDCCQKCSCCDNWTTYPPMGYETKIRICNDCNARMKDNPQIHTGITAMHLQETLGLLVTSGQNRVIMIWDV 404
44 -59.400[R] KOG2055 WD40 repeat protein  ali follow..  13  104................SDDERLMISLQDHSRLRKLRQYEDEDMVNGLQYARRLRTQF-------------------------------------------ERVYPVPEWAKKQDVTEEEDEFNALSEKSVIPKS----LKSLFKSSVSYINQSSKLLAPGTINIKRLKD--ANFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDGKVN------------PLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVENFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSFK-IEGVLSDVLFTSDGSMLVLSYGAEVWHFNVEQRSVVRRWQVQDGSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSKPVTTLDNITFSINSMSFSQDSQVLA-------IASRGKKDTLRLVHVPSFSVFRNWATPLGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAHYDLKFVPDKII-NWEIRLGKFGYVLLGIQIDVVI..... 555
45 -59.300[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  19  2.........................................................................................................................................................................................................KIKLIDSVVRS------------FKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDEKGTQSRTVNSKKYGVDLIHFTHANNTASSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDFLSGSLDKTLRLWDLRSPNCQGLM--HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDTFKLNQEKECDWTGLKFSRDGK---------TILISTNGSVIRLVDAFHGTPLQTFTGYPNNPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDGPVQCVQFNPKYMMLASACTNMAFWLPTS 313
46 -59.300[S] KOG0283 WD40 repeat-containing protein  ali follow..  14  218...............AVCGNGKALRGGGEALTSVMSNARVGAFLDTGKEFIVNEYDEDGMWNRLSDLQTGKQLTLSPVVKELMRRENVNRINYEPLMDLRKFNSYLSKSVRLSKRRGAALLKNIKG--VAHSMSLRVADKDVSDGSTDSPKKGKDHKHGKANEWVKVRPHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECE--------------LMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGSDKPVCSLKGHLDAILDLSWSKSQL-LLSSSMDKTVRLWDIETKTCLKLF-AHNDYVTCIQFSPENYFLSGSLDAKIRIWSIQDRH-VVEWSDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSQTNSQAKRKITSFQFSPVNPS--------EVLVTSADSRIRILDGSEVIHKFKGFRNTCSQLSASYSQDGKYIICASEDSQVYLWKNDFHRTRSTLTTQSWHGHVRGEPPPVQIHSKRHSKRISTSS. 765
47 -59.200[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  13  17...........................................................................................TKLDLQRVPRNYDPALHPFEVPREYVRALNATKLERVFAKPFLASLDGHRDGVNCLAKHPEKLAVLSGACDGEVRIWNNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEE-----------PLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDERTNPICSMTWGFDSISSVKFNPIETLLGSCASDRNIVLYDMRQATPLKKVI-LDMRTNTICWNPMEAFTAANEDYNLYTFDMRADTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYTKRMQHVICVKWTSDSK---------YIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDFQHYPHIKRIARHR-HLPKSIYSQIQEQRIMKEARRKEVNRIKHSKPGSVPLVSEKKKHV-VAVV 444
48 -58.800[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  18  1......................................................................................................................................................................MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQ------------ILIADLRGHEGPVWQVAWAHPGNILASCSYDRKVIIWREENEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEEVKKINNAHTIGCNAVSWAPAVV------------------------PGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGEEQKLEAHSDWVRDVAWAPSI-----GLPTSTIASCSQDGRVFIWTCDDASSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDVCISDVNKGQGSASVTEGQQNEQ............... 322
49 -58.500[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  18  121.......................................................................................................................................QRVISEGMLWKKLIERMVRTDPLWKGLSESR--GWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHN---------------LQRIQCRSENSKGVCLQYDDEKIISGLRDNSIKIWDKSLECLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGL-MVTCSKDRSIAVWDMASATLRRVLVGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQY-----------RDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRF--DNKRIVSGAYDGKIKVWDLQSTLCLRTLVEHSGVFRLQF--DEFQIISSSHDDTILIWDF 485
50 -58.200[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  13  54.......................................................................................................DEIDEENEDTYETAAEKRLRLAREYLDEVKNELVEDGGFDAKEVDRELLASRLKEDVLEKKGQMYIETAQLRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENRENDDHKFSRSRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSTLEPQHCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSLDQMSYIETLFGHQDVIFGVDALARERVSVGGRDRTSRLWKIVEESQLKATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFTYPLAHGLDPILAPGRHSTSLAAIPYSNLFASGSWDGNIRLWKIAEGLRSATPLSVYGCINSLSLSLQGKVFAACGRETRVGRWKTLRGIPNSGFVFNIPLTVIPSVTDGDEID............. 523
51 -57.700[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  14  27.........................................................................................PPTPDSSPAAPSKKHKLYDFLESRGKIETPRKRIVFEKKPLLHKPVHIIRQLGGSRSHPFSTKTSRHVGGRLNLETYY-SRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQNEEN---QPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCGVDGYHSHSVKQVNFCNDSPNLVSCSRDGSIIFWDMRTHGITHENSGRDCSITSATWLPQSTISSCSANSALKLWDLRTVHTVRTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSKDPRLRISSFYVKLACSPDGATLACGG-----GVQDKTSGVVVFDTTRNSSAMLTGGHTKDVTAVDWSSEGQ-LASISDDGSVRVWNSSLHGSAANLRNFSEIFYWGFSEK.................. 490
52 -57.200[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  17  3............................................................................................................................................................................PFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDT----------SNWELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPNKLCTLNDSKGSLYSVKFAPAGLKLACLGNDGILRLYDALEPSDLRSPANHLQSDFCLSWCPSREKLAVSALEQAIIYQRGKDGVAAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGR-----SDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSKCMSVITAQQ............................ 349
53 -56.600[R] KOG1334 WD40 repeat protein  ali follow..  10  63.YRDKNDHQHLPEGVSNKDFQSGATRKLLLPGVPDQLQQTSFEMSHQE--GSTGGLPDLVTESLFSSPEEQSGVAAVTAASSDIEMAATEPSTGDGGDTRDGGFLNDASTENQNTDSESSSEDVELESMGEGLFGYPLPRMCPRCGGTNHDQCLLDEDQALEEWISSETSALYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNFE-------------SGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINENTKRVAKHRGPAHELALEPDSYKFLTSGEDAVVFTIDLRQDRVVTRENDKKVGLYTISMNPANIFAVGGHDQFVRIYDQRRIDHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDGAQYVKRYKGHKCVNFYGPRSE---------FVVSGSDCGHVFFWEKSSSQIIQFMEGRGDIVNCLEPHPYLPVLATSGLDQHVRIWTPTAKTATELTGLKDVIKKNKQERDEDNLNYTDSFDNRMLRFF 632
54 -56.400[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  15  2.............................................................................................................................................................................TFVGHDTSILAIDCHPSGKKFITCGSNGLVVVWNAEP---VLDKKKASNENVPKLLFQVESQSQSNSCRWSPDGKRFAFGSDDSSVSVWEYVGKECCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKPDRITVLNDIQLPVKGLSWDPIGKLASLEGDKKLRFWATDSWQCVKSVTIEETMLTRLDWSPDGKYLMTPAAVRLIKLIQRQTWKSDQFLAGHHKGTTCVRAMPR-LKNGKRMQLTCAAVGSRDKSISIWVFPGTLKPLFVINNIFNHTVMDFAWCGRNLLACSQDGTVKVIHLSESVIGEMISNEA-CYQIYSIRPPRYELTDKEEDES..... 385
55 -56.200[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  13  2.............................................................................................................................................................AQPYLPAEKFLQETILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVCE--------------PLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVSKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYIIEIQAHEDAIRCGAVSSINIVLTGGYDHKVRLWDIRSKEKSLEL-DCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGRQLTALQAHYKTVTSLRLATNST---------CLLSAGIDRRVNAFRTTNYSLINSW-SMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKKEATASAAIDKRSLIRTSAPPVKLVEKDRDMQKVDVVA 358
56 -56.000[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  14  36.........................................................................................DFDFANYALTQGSKRNLDEVTSASRKAYMTQLAVVMNQNRTRI-----AFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSAPGLRDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSGST------------SELVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLRGGHESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSIVETYLGHTEEVCGLKWSESGNQASGGNDNVVHIWDRSLAQWLHRFEEHTAAVRALAWCPFQASLLATGGDGKIKFWNTHTGACLNSVETGSQ-VCSLLWSQSEREL-------LSSHGFTQNQLTLWKYPSMSKMAELNGHTSRVLFMAQSPNGCTVASAAGDENLRLWNVFGEPPKTTKKAASKKYPELFSHVNSL............... 443
57 -55.600[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  19  4.........................................................................................................................................................................ITCEIAWHNKEPVYSLDFQHGTARLASAGVDTNVRIWKVEKGPDGKA-------IVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNWTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQVATLSCDRVLRVYSIQKKRVAFNVSSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTKRPIAHLPCPGKATLAVRCCPVYVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKP-VLNMRTPDTAKKTKSQTHRGSSPGPR. 414
58 -55.300[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  17  2...........................................................................................................................................................ADDGLGDVPMETESTISHVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQYTKTHA-----------FEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPQAEPYAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITESFTTIVCPGHTLSVWALASFPDLTYLSASADKTIRMWF--GDTTLSVFKGHTDVVRALVVLSSSH-FLSAGNDGHIIHWDVASASILRKFATQAHEF----------IYSMTLSDSHILTTGEDGTLEFWAIDGGKSEAVIQLPTTNTWDAKVLLNSD-IAVAGSDGRIYIMTTDKNRKADD-AFDAEVVAKLTAKTERMKQEEHETVTIKV... 362
59 -55.300[R] COG2319 FOG: WD40 repeat  ali follow..  15  141....................................................................................................................................AKLQKSDMTQKCPTMVASEKDNKGKLNEKKNRSPENLLPFRILDRDDFYTSLLSWSPKGDLAI--GLAENIYLWSKELGP---------------TRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERVPRISIHHPGDIGVLAWKPETNRLLVGKGNGNIFVYDIIAVLVATITNAHDEQVCGLTWNHDGSFASGGNDNRVCLFKGSDLRQPLYVWQQNAAVKALSFCPWQRSLLAGSHDKHIRFYNCFNGKKIDELYCGA-QITSIHWSPKYREFSVTFG---YSLETVQHRFAVYSWPQLECLVSVLVPDIRCVHSVLTSQTDSIIIASSNETIKFFDLSEESSWHNSRVLTWDSQILEMLEG---IDGKIDSHLR.... 535
60 -55.200[S] KOG4328 WD40 protein  ali follow..  11  2..ATEYERKRL--ENIRRNDEMLAALNVRAKASSLLSAAKRSRDDSKSFKKKKPK----PASTPTVIRMSLRTRGLNPDSAGLPDGFSDFRMGSQITHNQPSPQKQSPRLLAPIPFESAYEGYGSYTQLVDTLLGIESKSCRGKLVKGEIGVVKDENESPMVRTRSSSRVSKVSVKKEEPEDDSFSDYVNKEFSIPVKPEKIEFDLDLLTLEPQNVARV--------------VPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDNDGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSV-FDLVYSTDEAIFSLSQRPNDELYFGQDYGVFNVWDLRAGKSVFHWELHERRINSIDFNPQNPVMATSSTDGTACLWDLRSKPKTLSTVNHSRAVHSAYFSPSGL---------SLATTSLDNYIGVLSGANFENTCMIYHNNTSKFKAVWGWDDSYIYVGNLSKKIDVINPKLKRTVMELHNPAIPCRIHCHPNVGTLAGSTAGGQVYVWTT 515
61 -55.100[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  13  1...................................................MLNHNVSFSSTMVTSNGDLSLPKSAEEILKLRSGRPKNAVESPHAGVPMETSLAAEEEANGDEEEESVRVVDIED---TLELTSNGNEAKPEDQELAIAPVLQYFQGALVELGRRCWTSS----TEAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDLYSADTVQPARSLTKLQSEVHPEGGTVYDCVWYPHMNLWLATRQHEPIHMWDADGSLRCSYSGYDMAAISLAFSHDGEQIYAGY-KRCIKIFDTSRPGRFCDDYPVKFAISCIAQTTAHPLTCGNWHGYIQHFDLRCSHPLFTLGGHKGGITQLRYGEFGNLFSGARKCDKILQWDMRNKQPLVELQRHVDTNQRIQFD--------ASDSNWLASGDTRGFVNVWDLKKYGDPSVLPLHSDCCNGVALNPAMPILATSSGQ---FHFTDQSAQGDNVTLNGETTELPAPADVNQNQKEVLYENAVVMWWC 483
62 -54.700[R] KOG1273 WD40 repeat protein  ali follow..  12  15....................................................................................................................................EVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDGIAKEIRDNSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQTLSSPSLCLACPLSSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQRSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVSSGAAPVKNIVFSRNGQLLTNSHDRTIRIYENLLPAKNKMKTVTKMHWKAPCFSGDGEWVVGGSGEHKIYIWD-RAGHLVKILEGPKEALIDLAWHPVHP---------IIVSVSLAGLVYIWAKDYTENWSAFAPDFKELENEEYVEREDEFDLIPETEKVKVLDVNEDEEVDIDTVEDAFSDSDMSVEELRYLPAEPIPDT..... 426
63 -54.700[R] KOG0646 WD40 repeat protein  ali follow..  14  2.......................................................................................................................................................EITVIASSSIDEGIGSWGTEQLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSWTKPQ---------------AEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVTGKLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRTLYEHNFNEHTMSVTDIVIDYGGCIISSSEDRTCKVWSLSRGKLLKNI-IFPSVINALALDPGGCVFYAGARDSKIYIGAINATQVLGSVSEKGKAITCLAYCADGN---------LLISGSEDGVVCVWDPKSLRHVRTLIHAKGSRKGPVNNQIVRKTIVANSNKTQVSWKSRGALIPPPLEKYER--PVEDTMDGIVTVDPPPFSDVPVYS. 373
64 -54.600[R] KOG4227 WD40 repeat protein  ali follow..  12  9..........................................................................................................................................GSMRSVVGFLSQRGLHGDPLLTQDFQRRRLNLYKKDLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQAIHSRV---------KPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVFAHEDAVYGLSVSPVNNIFASSSDDGRVLIWDIRESPHGECLANYPSAFHSVMFNPVELLATANSKEGVGLWDIRKPQSRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDFNSCTMKSCCFAGDRDQ--------YILSGSDDFNLYMWRIPANGAFMVLKGHRSIVNQVRFNPHTYMICSSGVEKIIKIWSPKQPGCTGDLDGREDDSRCLYTHEEISLVLNSGSGLSHDYA. 405
65 -54.500[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  14  2..................................................................................................................................................SFFNRSNTTSALGTSTAMANEKDNDIVINSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGVPQGRA-------------QHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPER-VYSMDNKQSLLVATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMPGSNGQSLVYPVNSIAFHPLYG---------TFVTAGGDGTFNFWDKNQRHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHA-TTDEEVKEKKKR............... 365
66 -54.200[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  12  1....................................................................................................................................................................MASNQQPPSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSSYIVLSGTNSLSEQPIGRRVIGTDLPYRMAIHPRQGGLICAL-PNSCRLFDEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLGAPLCRVWDVNASAAIASLSKEKDEFASCRFSVDNSVAANTQRGGSIITWDTTSWRRRSSLIKRNNSISAFNVSADGK---------LLAVGTLEGDVLIIDSTKMQTNQIVKAHLGLVTALTFSPDSRCLVSVSFDSRARLTVIKQKGEKRRV--AALLFVLVYVVLYYLMVAMGII........ 382
67 -53.500[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  19  11................................................................................................................................................DNKKYAVDDVPFSIPAASEIADLSNIINKLLKDKNEFHKHVEFLIKGQFLRMPLDKHMEV-----SSEEVVEIEYVEKCTAPQPEQCMFHDDWISSIKGAEEW--ILTGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVEKALHCCRGHAGSVDSIAVDGSGTFCSGSWDKMLKIWSTVPTDPIVTLSGHMEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGSLKSTL-TGNKVFNCISYSPLCK---------RLASGSTDRHIRLWDPRTKDVSLSLTSHTGWVTSVKWSPTHQQLISGSLDNIVKLWDTRSCKPLYDLAAHEDVLSVDWTDTG-LLLSGGADNKLYSYRY 414
68 -52.700[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  12  4........................................................................................................................................SEVFKLSSLLCKFSPDGKYLASCVQYRLVDVNTLQILQLYTCLDQIQHIEWSADSLFILCAMKRGLVQVWSLEQPE---------------HCKIDEGSAGLVASCWSPDGRHILNTTEHLRITVWSLCTKSVSYIKYPKACLQGITFTRDGRYMALAERRDCVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCLAVWDTCLEYKILLYSDGRLLSTYSAYEWSIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFANPKMGIGMLAFSPDSY---------FLATRNDNNAVWVWDIQKLR-LFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDAVLSLCWHLSGDSMALLSKDHFCLCFLE 444
69 -52.300[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  13  7........................................................................................................................................................................SAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEF---------------LHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGKEDILGTHDKAVRCVLFCDVTGQVITGSWDKTVKCWDPRGASGPERTQTYLQPERVYSMSLVGHLVVATAGRHVNIYDLRNMSQPRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEKSEAGRDIVYPVNSIAFHPIYG---------TFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTAIFVRSVNEIEVKPKPKVYPN........................... 351
70 -52.100[R] KOG2321 WD40 repeat protein  ali follow..  7.........................................................................................................................................NPNNVRVYTVSGEGVTQRLPNWISKRKLKKDYALSHRIEEYPEASNRIKCTRDGKYAMATGVKPHIKVFDFAEMSLKFERH--------------TDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYST--RIPKYGRDLKYHYPNCDLYLAAAGDEVYRLNLEQGRFLNPLKSPTGGVNVIDINPMHQLAFGTDAGSVEFWDPRDRSRVGILEDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSDQGYSMPIKSLHWMDSAL------DGTARVLSADSKIIKIWEKDTGKPFSSI-EPTVELNDVCPIEGTGLILTANEGSPMHAFYIPSLNPAPRWCSFNITEEMEENPDDYKFVTKKELLNLGLDHL 401
71 -51.100[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  11  2.............................................................................................................................................................AGAGGGNDIQWCGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNQFLLSTNDKTIKLWKISSPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDRSANMEELTEVITAAEFHPNSCFVYSSSKGTIRLCDMRASALCSFFSEIISSISDVKFSHSGRYMMT-RDYLSVKIWDLNMNRPVETYQVHEYDKFECCWNGSDS---------VVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLD----------NKKILHTAWHPKENIIAVATTNN-LYIFQ. 443
72 -50.800[R] KOG2444 WD40 repeat protein  ali follow..  1.............................................................................................................................................................................MLVEFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEI-----------WKFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDITGKRVRCIKCHRSVPTAICTLPKSQQLATADESGEVKTWNLDPNANIRKWQEQDEDINDLKVDVKSNLLATSSDGTLGAYDLRKAKLKMRSELMHSEL--YSVCGTNRSVYVGGEDGYVEVFNLNENLLERVESGFEMGVNGIVELRSGL---------LGLTSQGSNRMRLLNVQPSKRLGYAGYHDDGIDAITISTDKSTVTMISMSCTIKKWDMGPIIDEIPILRAQDAKSKKMRKTEGFFDGLVGPKNDSDSD. 346
73 -50.600[S] KOG0294 WD40 repeat-containing protein  ali follow..  10  2............................................................................................................................................................................................PPEMEIIEATNEELLLGFKLIKSPTDGFTD---SVKFELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAGQAVTHVSCHPSSKALSLGGDQVLNTWNLVNGCVAHKTNTLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHVMRRIE-MPSKPICITWLDGN----------ECLTGLDNGNIAWISLKDEDPPTFILAHEVRVKAIAYL--NEFLATVSIAGQIKVWKIDMEEEIARSFMDCRPTDLGLLDLRQFGNVRPVEQRTKVEE. 332
74 -50.400[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  13  2...........................................................................................................................................................DDIEDSLDQWKFAQCFGDKGITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEKSLEIEEKINKIRWCKRTNHFLLSTNDKTIKLWKLEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYNAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSENMEELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSASKSFFSEIISSISDVKFSQNGR----------YILSRDYLTLKIWDVNMKAPVKTIPLHDVDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDNLDYNKKILHASWHPFEDSVAIAATNN-LFVFS. 461
75 -50.000[S] KOG0270 WD40 repeat-containing protein  ali follow..  12  20YVLDDEEVERINQLAQLNLDDAKATLEEAEGESGVEDDAATGSSNKLKDQLDIDDDLKEYNLEEYDDEEIADNEGGKDVSMFPGLSSLPNQEDSQEEKQELQVYPSDNLVLAARTEDDVSYLDIYVYDDGAGFHSSD-IPVEEGDEADPDVARGLVRDPALYVHHDLMLPAFPLCVEWLDYKVGSNSEEAANYAAIGTFDPQIEIWNLDDNSMVSLKSKKKKKKSKTGHITTHHTDAVLSMAHNKYFRVLASTSADHTVKLWDLSGNAARSLAHSNKNVSSSEWHMNGSILLTGGYDSRVALTDVRISDESQMSAMAGEEIETVTFASENIILCGTDSGNVYSFDIENRKPVWTLKAHDAGISTLCSNKPGMMSTGAMGEKTVKLWKFPLDSMVLSRDFDVGNVLTSSFAPDIE------VAGTMVIGGVNKVLKLWDVFTNRSVKSFKSELENVQARAKEEAQKIGKSSRIARKYTSNDNPDTVITIDDQGEDEEREGGDEHDDM................ 575

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.