current user: public

If you have questions about the server, please let us know.

Query: [O] KOG0549 FKBP-type peptidyl-prolyl cis-trans isomerase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MKTAVIVGLLCLLAIAYAADEQKIDKLQIGVKKRAENCVQKSRKGDQLHMHYTGTLLDGTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELMKIDRDGEELLast
1 -80.400[O] KOG0549 FKBP-type peptidyl-prolyl cis-trans isomerase  ali  100  1MKTAVIVGLLCLLAIAYAADEQKIDKLQIGVKKRAENCVQKSRKGDQLHMHYTGTLLDGTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELMKIDRDGEEL 139
2 -56.300[O] COG0545 FKBP-type peptidyl-prolyl cis-trans isomerases 1  ali follow..  32  109.............FLEENGKRDGVTTTASGLQYEIKADGPQPKATDVVTVHYEGRLTDGTVFDSSIERGSPIDLPVS--GVIPGWVEALQLMHVGEKIKLYIPSELAYGAQSPSPAIPANSVLVFDMELLGIKDPSKP. 233
3 -54.000[O] KOG0544 FKBP-type peptidyl-prolyl cis-trans isomerase  ali follow..  40  178...ASLTCKVRLFNCSWDSYAKIGV---DRQILVQGDNVTKSKNGQTVTCHYVLILVDGTKIDSSRDRETPFKFKIGKGEVIKGWDQGVAQMSVGEKSKLTISADLGYGPRGVPPQIPANATLVFEVELLGVN...... 304
4 -52.300[O] KOG0552 FKBP-type peptidyl-prolyl cis-trans isomerase  ali follow..  34  244...............SNAPSSPKTRTLKGGVVVTKTGSGASATNGKKVEMRYIGKLENGKVFDKNT-KGKPFAFILGRGEVIRGWDVGVAGMQEGGERKITIPAPMAYGNQSIPG-IPKNSTLVFEVKLVRVH...... 361
5 -29.000[O] COG1047 FKBP-type peptidyl-prolyl cis-trans isomerases 2  ali follow..  26  4..........................................QKGDFIKLNYTGRFEDGRIFDTTDEEYGGDVVIVGAGHTIEGLDEDLEGKEAGYSSTVTIPPEKAFGLSNSKETVSAGKTVSYEYTIEKLLEDDVE. 154
6 -28.800[O] KOG0543 FKBP-type peptidyl-prolyl cis-trans isomerase  ali follow..  29  10...ESAAQPVPLPKKEVDVSPKQDEGVLKVIKTEGTG-TEMPMTGDLVFVHYTGWLLEGTKFDSSVDRKDKFSFDLGKGEVIKAWDIAIQHLEKGEHSTVYLKPSYAFGSVGKEKQIPPNAELKYELYLKSFEKAKE.. 227
7 -13.800[O] COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor)  ali follow..  22  172.......................................GKAENEDRVTIDYLGKL-DGEPFEGG--ADNDAQLVLGSGQFIPGFEEQLIGLKAGDEKVITVTFPAEYGAAHL-----AGKEATFDIKVKEVAKPN... 260
8 -5.950[O] KOG3259 Peptidyl-prolyl cis-trans isomerase  ali follow..  12  55VRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSD----CSSAKARGDLGA-FSRGQMQKPFEDASFALRTGEMSGP-VFTDSGI............................... 156
9 -5.800[M] COG1898 dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes  ali follow..  11  25.............YFSEVFKREWFRENVANVEFVQDNESLSAQAGTVRGLHFQ-RCIRGRLLDVAVD--------IRTGSPTFGQWAAVE-LSPENGEQLWVPAGFAHG------TLVADTVISYKVT........... 135
10 -5.770[L] COG1604 Uncharacterized protein predicted to be involved in DNA repair (RAMP superfamily)  ali follow..  23  261.............................................DIMNPHY-QPYYQHGEPPGDWHSPNPIFFTVPAGKAEKLLKEALKKFGVGAK------TSLGYG.............................. 335

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.