current user: public

If you have questions about the server, please let us know.

Query: [JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1), from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEALast
1 -103.000[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali  100  1MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA 325
2 -71.200[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  16  458....TLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPLLGHTDAVWGLAYSAAHQRLLSCSADGT-----LRLWNTTEVAPALS--VFNDIKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLENSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGKLIHSMAHLEAVTSLAVDPNGLYLMSGSHDCS--------------IRLWNLESKTCIQEFTAHEESIHDVAFHPSKCYIASAGADALAKVF............. 779
3 -69.800[R] KOG0286 G-protein beta subunit  ali follow..  17  50....TLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVAHTGYLSCCRFLDDNNIVTSSGDT------TCALWDI------ETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSIICGITSVAFSLSGRLLFAGYDDFN--------------CNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN............ 340
4 -69.400[S] KOG1407 WD40 repeat protein  ali follow..  17  11LHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIESKAKDLELKGHTDSVDQLCWDPKHSLVATASGDKSVRLWDARSGKCTQQVELSGENINITYKPDGTHVAVGNRDDE-----LTILDVRKFKPLHR-------RKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDMLCLRTFKLEWPVRTISFNYSGEYIASASEDLF--------------IDIANVQTGRTVHQIPCR-AAMNSVEWNPKYNLLAYAGDDKNPKYNTDEGVFRIFGFE. 313
5 -69.200[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  22  49...MQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFGHGNFVNSVQGSRRGQQLLCSGSDD----RTIKIWDARKKHAAHT--------ESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPYAP-HQHNFEKNLLRCAWSPGSDKITSGSADRH--------------VYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE......... 347
6 -68.500[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  20  99....QLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPECRMSSDDHRFDPGNEETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILASLEAQTESVEAIALCTALPICACASVDGTVALYDSASLKFRKSLPHEQAVIDCKFLPNTPYLLTACADCV--------------IRKWDVRSGQLLGEYTGHQEPILCMAITPDGKRVVTGSDDTELLVFDCEH......... 399
7 -67.600[S] KOG0282 mRNA splicing factor  ali follow..  15  283....VWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYGRRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDLFVAGMSDKK-----IVQWDI------RSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKMVAGYACQVDFSPDMSYVISGDGNGK--------------LNIWDWKTTKLYSRFKAHDKVCIGAVWHPETSKVITCGWDGLIKLWD............ 579
8 -66.600[T] KOG0279 G protein beta subunit-like protein  ali follow..  16  10....TMCAHTDMVTAIATPVDNDVIVTSSRDKSIILWKLTYGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFGHTKDVLSVAFSTDNRQIVSASRDRT-----IKLWNTLG----ECKYTISEADGHKEWVSCVRFSPNTLTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEDLKEAEKTDGSTGIGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGR......... 325
9 -66.300[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  17  13....ILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRGILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRVIRKFGHDGEVNAVKFNDSSSVVVSAGFDRS-----LRVWDC------RSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDNLGQP--VNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGHISKTDCCLTNSDAHVIGGSEDGL--------------VFFWDLVDAKVLSKFRAH-DLVNSIDVDFYLRKFFVAGDKRELPPEGRLYVDFFGRWYN 311
10 -65.900[R] KOG0289 mRNA splicing factor  ali follow..  21  216....LHSASIPGILALDLCPDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVAHESAVTGLSLHATGDYLLSSSDDQY-----WAFSDIQTGRVLTK----VTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLDNNFEVKSLIFDQSGTYLALGGTD----------------VQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL........... 504
11 -65.800[S] KOG0293 WD40 repeat-containing protein  ali follow..  17  269....ILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADSLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMYKGGISPISCGWYPDGQGIIAGMTDR-----SICMWDL------DGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATV--ERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKIVSRRSRFIIRSCFGGYKQAFIASGSEDSQ--------------VYIWHRSTGKLIVELPGHAGAVNCVSWSPTNLMLASASDDGTIRIWGLDRINQQNQKK. 571
12 -65.800[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  15  18....IFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVNSKKYGVDLIHFTHANNTASSTKVDDTIRYLSLHDNKYLRYFGHTKKVISLCISPVEDTFLSGSLDKT-----LRLWDLRSPNCQGL---------HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDTFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFNNKGIPIEASFSPDSQFIFSGSTDGR--------------VHIWNADTGNKVSVLNGHPGPVQCVQFNPKYMMLASACTNMAFWLPTSEEG........ 316
13 -65.100[R] KOG0645 WD40 repeat protein  ali follow..  14  1......SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGHTRSIRRVAWRPIERVLAVASFDSVVSINEKIDDDTAALEGHENEVKCIAWSCNGNYLATCSRDKS-----VWIWEATED---DEFDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWDGDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNEDVATIHKGAVYTISWMNDAT-LCSAGGDGKIVVYQREKHDEA-------LWHVAYEQDHAHGVYEINSLEYLRDDR-LLSGGDDGECRVWSFK.......... 322
14 -64.800[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  13  319....TFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKDSDGSVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYGHTGPVWDVAFGPFGHYFATASHDQT-----AQLWSC------DHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGHSVRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTMGHRGNIYSLSFSRESTVLVSGGSDCTVRAWDVFKTNTSTFNEVNWSTSPDQMVALYTKQTPIFNVSFTRRNLCLAISVS.................... 643
15 -64.400[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  16  3....LHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFE-------AENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKESEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKEFLPLLSVSFVSENS-VVAAGHDCCPMLFIYDDRGCLTFVSKLDTTEDRNTALETLHQNSITQVSIKQDCRKFCTTGIDGAMTIWDFKTLESSIQ... 365
16 -64.100[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  16  171.KATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSEGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIW-----------DAHTGEAKQQFPFHSAPALDVDWQNNMT-FASCSTDMCIHVCRLGCDHPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLAHSKEIYTIKWSPTGPATSNPNSSIML-----ASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSYQG 492
17 -64.000[S] KOG0295 WD40 repeat-containing protein  ali follow..  16  59....LQRKVNDLESKLQESQREINHGAPTRDKRQAADWIPRPPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLGHTDAVNDIAIDAAGKQLVSCSSDLS-----IKLWDFGQ-----TYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLDHEHAVECVEWAPDTAYTVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEA 372
18 -63.400[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  14  100....SIPGHGEPVISAQFSPDGRGLASGSGDQTMRIWDIELELPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIGKTRHKQWITSLAWQPTCRLLASCGKDGNIFIW-----------DTVQGTVVRCLSGHTASVTCLRWGGEGL-IYSGSQDRTVKMWRADDGVMCRNMTGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQKVA--QTRYEAALEIAGGERLVSGSDDFTLFMWNIASASFDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPG 442
19 -63.000[A] KOG0285 Pleiotropic regulator 1  ali follow..  16  163....VLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYGHLHGVYCLALHPTLDVVLTGGRDSV-----CRVWDIRTKMQI-------FVLPHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSMATITNHKKTVRAMALHPKENDFVSASADNIKKFSLPKGEFCHNMLSQRDIINAVAVNEDG-VMVTGGDKGGLWFWDWKSG------HNFQRAETIVQPGSLESEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDEDATPETHP. 465
20 -62.900[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  74....KSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKDILSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLIKEIQVRETVRDVAFLHNDQFFAAAQKKSVNMSGQLHYQDV------THGGMVASIRTGKGRTDVMEVNPYNSVVGLGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTI-HSFHAKTLSFSQKGLLAAGTGSFVQILGDSSGGSS---------HNYTRYMNHSMVKGYQIEKVMFRPYEDVIGIGHSMGWSSILIPGSGEPNFDSWV 420
21 -62.600[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  409...ITIGGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRSTLQCIRTMTCEY--ALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLETIAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRLSVKQTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFGDCHKSLAHDDSVMYLQFVPKSHLFFTAGKDHK--------------IKQWDADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWERTREPLILE... 712
22 -62.500[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  14  20IRDEHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPHHKDAGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERDNKHGFITHKDYVSCLAYAPIVEKAVSASFDHN-----IFVYDINA-----NFKTVNNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATCAHEEGVWTLQVDSSFTTVYSAGKDKMVVKTPLYVGTWKSDIKRWSIRPSAQLSIGGDEDGPIKKHAMLSDKRHVLTRDSDGNVALYDVLAARKIKDYGK 431
23 -62.400[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  14  387...MKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFPNPAQFSCVAVDYSGELVVAGGQDV----FDIFLWSV------KTGKLLEIISGHEGPVVSIAFSPTSSTLVSGSWDKTVKIWNCLESNSEHETIDAVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTTIAQANYFSTIEYSADGECILAAGKSANICIYHVREAIGRVAIRLPGVQRGDMSSRRFQQEVRVFSVKFSPTGQAFAAAGTEGLCIYA-LDKGVVFDPFDL 764
24 -62.100[R] KOG0646 WD40 repeat protein  ali follow..  13  2....................EITVIASSSIDEGIGSWDLKTGTEQLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSWTKPQAEVKSYPVEPIKALAANNEGTYLVGGGISG-----DIYLWEV------ATGKLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRTLYEHNFNEHTMSVTDIVIDYGGCVIISSSEDRTCKVWSLSRGKLLKNIIFPSVINALALDPGGCVFYAGARDSKIYIGAINAT---------SEYGTQVLGSVSEKGKAITCLAYCADGNLLISGSEDGVVCVWDPKSLRHVRTLIH 303
25 -62.100[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  26....RITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSNKMG--SYLLENSCTAMVIDLPFVFVGDHGG-----HVTVLRIVD----NQPNLVSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGREAYELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPERTCGSAVCGSCCDNWTTYPPMGYETKIRICNDCNAR---MKDNPQNFNLTPLAIPHEIHTGITAMHLQETLGLLVTSGQNRVIMIWDVRSVCSAPS... 412
26 -61.800[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  13  18.TILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVCEPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVESKVALRVMASQSTVKSVHFSPRGDTVFSMADDGK-----IKQYRVADTAYGVNAVPIIEIQAHEDAIRCGAVSSNDHIVLTGGYDHKVRLWDIRSKEKSLEL-DCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGRQLTALAHYKTVTSLRLATNSTCLLSAGIDRR--------------VNAFRTTNYSLINSWS-MPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKKEATASAA 327
27 -61.500[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  13  98.ETAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKAFTDCEPVLCLSFHPTGDYVAIGTEHNV-----LRVYDVATTQCFVS---AIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYKQEHQTEAVFNHTEDYVLFPDEATTS--------------LCSWNSRNGCRLTLSLGHNGPVRYITHSPNGPAFLTCSDDFRARFWYRRANN....... 423
28 -61.000[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  10  10....KLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTMDKVKVFAHSDYIRCVAVHPTLPYVLSSSDDML-----IKLWDWEK-----GWACTQIFEGHSHYVMQVTFNPKDNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTKSCVQTLGHTHNVSAVCFHPELPIIITGSEDGT--------------VRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLGREI........ 303
29 -60.800[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  11  1...MSLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGCIQTYGHTRGISTIEFSPDGRWVVSGGLDNV-----VKVWDL------TAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVICRDGVDMGWSTLGDFCINEGKFIGCSYYRNSVGIWVSDISE-LNDQSERMGSGPRGSVSPDYETREIKNIYVDSTGGNLNVAQNPGSLKATLPLESGKVATMVS 331
30 -60.400[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  17  18....LPRTQRGQPIVLGADPKGKNFLYTN-GNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKNPIAGPIKDISWSPDNQRIVAVGEGRERFGHVF---------MSETGTSVGEISGQSKSINSADFRPARPFIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELSGVITYLNVADSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSGT....... 358
31 -59.900[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  16  4....FDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDNWELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDQLCTLNDSKGSLYSVKFAPAGLKLACLGNDGI-----LRLYDALEPSDLRSKVLSIPPANHLQSDFCLSWCPSRFEKLAVSALEQAIIYKDGKLHVAAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASESLTNSNMFDNSADVDMDAQGRSDSNTEEK----------AELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSKCMSVITA 347
32 -59.800[R] KOG0288 WD40 repeat protein TipD  ali follow..  21  226....RIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRHTLGHTDKVCAVDVSKFSSRHVVSAAY----DRTIKLWDLHKGYCTNT--------LFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGTLRASSNWSRSCISPDDDYVAAGSADGS--------------VHVWSLSKGNIVSILKEQTSPILCCSWSGIGKPLASADKNGYVCTWT............ 515
33 -59.600[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  15  61....SLDGHRDGVNCLAKHPEKATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEETILGKTVYTGIDHHWKEAVFATCGQQ-----VDIWD------EQRTNPICSMTWGFDSISSVKFNPIETLLGSCASDRNIVLYDMRQATPLKKV-ILDMRTNTICWNPMEAIFTAANEDYNLYTFDMRALDTPVMVDHVSAVLDVDYSPTGKEFVSASFDKS--------------IRIFPVDKSRSREVYTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTS 365
34 -59.400[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  12  393....YLRERFLRCLDLYLCPRAKRVKLNIDAEYLIPKLPSPRDESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTIETDEVVRCVAWCPNPKLSIIAVQDVIESERIKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQELVKKLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLDL-------------STKPYQTMRLHRNAVRSVAFHLRYPLFASGSDDQAVIVSHGMVYN-LKKLQT 750
35 -59.300[R] KOG1273 WD40 repeat protein  ali follow..  16  15.EVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKEIRDNSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQTPLQARLNPGLSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQRSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVSSGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPAKNKMKTTKMHWKAPCFSGDGEWVVGGSACKG-----------EHKIYIWD-RAGHLVKILEGPKEALIDLAWHPVHPIIVSVSLAGLVYIWAKDYTENWSAFAP 357
36 -59.100[R] KOG1334 WD40 repeat protein  ali follow..  15  272....LLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNFSGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINASYCENTKHRGPAHELALEPDSPYKFLTSGE----DAVVFTIDLRQ-DRPASKVVVTRENDKKVGLYTISMNPANYQFAVGGHDQFVRIYDQRRIDKKENYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDGAQYVNNDTIKCVNFYGPRSEFVVSGSDCGH--------------VFFWEKSSSQIIQFMEGRGDIVNCLEPHPYLPVLATSGLDQHVRIWTPTAKT....... 595
37 -58.900[R] KOG2096 WD40 repeat protein  ali follow..  14  81....TLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDARFLRINLPAGGHPTAVAFADDASSIVVACHHMSSIKWDHHHIHEKRSVTISGATATYGTADGSVVIASCSEGTD-----IVLWHG------KTGRNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDE-GNPLHYDRLSLCPEGKILAASHGS---------------TLQWLCAETGNVLDTAKAHEGDITCISWAPKAMVLGTSGDDKKVKLWEAPKSQSL..... 454
38 -58.600[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  12  436...LAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVNRDNYIRSCKLLPDGCTLIVGGEAST-----LSIWDLAA----PTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNSTGKDNLLNAWRTPYGASI-FQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV........... 768
39 -58.600[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  15  410....VPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSESHKLYGHGNELFSLCSDHKGNLVASSCKAQSASMAEIWLWE------VGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQRTKLMAKVEAHKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQIPFGSSVTAVAWTGLDRCVAVGMESGLIELSNVKIIETEEGTT--TAALALRLEPFMCHVSAVNRLAWRPTEKWLTSCGDDNCVRVFNFK.......... 839
40 -58.500[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  17  122....CLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLYHSHSVKQVNFCNDSPYNLVSCSR----DGSIIFWDMRTHGITIDGEHFQENSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTVRTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSGPRLRISSFYVKLACSPDGATLACGGGVQD----------KTSGVVVFDTTRNSSAMLTGGHTKDVTAVDWSSEGQ-LASISDDGSVRVWNSSLHGSAANLR. 475
41 -58.300[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  14  136....LRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENRNDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLEPQHCWHHRDAVMGLAMRRGTNEMFSCSADRS-----IKVWSL------DQMSYIETLFGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLKATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFTYPQPRWITSLAAIPYSNLFASGSWDGNIRLWKIAEGL--------RSFEPLTIATPLSVYGCINSLSLSLQGKVFAACGRETRVGRWKTLRGIPNSGF.. 504
42 -58.000[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  14  74...INFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVEVDASIQDVAISPDGRYLAAANNKGN-----CYIWSLTSQDQMSTLRPNRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYGHTKAITALSFKDEIPVKSTNISDVQSSAKPPTQ--------------------RDNPPGTNNLAFFETVGRVAMNPYMGNTTTELN............ 362
43 -58.000[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  13  117...AKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWSETVGHTATVNCVEFNPLNKNEFISCSDD----GSLRLWNLDDHKVIRKVIKTKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKVKTGLENAFKSTDCGFSPRAEVVFTGTSS--------PNKDTPGTLQFFDPMTFDLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQTMSQRGVMSC 458
44 -57.800[S] KOG4328 WD40 protein  ali follow..  13  209....VARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGDGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSVFDLVYSTDEAIFSLSQRPNDEQSLYFGQDY----GVFNVWDLR------AGKSVFHWELHERRINSIDFNPQNPVMATSSTDGTACLWDLRSKPKTLSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYHNNSKFKAVWGWDDSYIYVGNLSKKIDV--------------INPKLKRTVMELHNPRAIPCRIHCHPNVGTLAGSTAGGQVYVWTTK.......... 516
45 -57.800[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  14  124.......RDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSGSELVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLRGGHESRVGSLAWDNHILTTGGMDG-----KIVNNDVRI-----RSSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLAQWLHRFEEHTAAVRALAWCPFQASLLAGVGDGKIKFWNTHTGACLNSVETGSQVCSLLWSQSERELLSSHGFT------------QNQLTLWKYPSMSKMAELNGHTSRVLFMAQSPNGCTVASAAGDENLRLWNVFGEPPKTTKK. 427
46 -57.800[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  14  12....LSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEF-LHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGKEDILGTHDKAVRCVLFCDVTGQVITGSWDKT-----VKCWDPRGASGPER----TQVGTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQPRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKDIVYPVNSIAFHPIYGTFATGGCDGF--------------VNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTAIFVRSVNEIEVKPKPKV 348
47 -57.700[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  19  195.NLQRIQCRSENSKGVCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLNTLHHNEAVLHLRFSNGL--MVTCSKDRS-----IAVWDMASA---TDITLRRVLVGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQY--RDRLVVSGSSDNTIRLWDIECGACLRVLGHEELVRCIRF--DNKRIVSGAYDGKIKVWDLQAA-----LDPRAPASTLCLRTLVEHSGRVFRLQF--DEFQIISSSHDDTILIWDFLNVPPSAQNET 496
48 -57.600[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  314....IVGFHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSPENDSCGHANTVTALAISNTGRFLASVSTDCTIKLWGLGV-EKDFVEQLPKLTCSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKIAGTLSGHRRGVGDVKFAKNSHKLASCSGDMTIKIWNISEKSCLQTIGHSCAVFRVIFARNDSQLISADSAGI--------------IKIWTIKTADCECSIDAHTDKIWSLSKNHNESEFVTAGTDGRIVVWKDVTEEKQKAEDN 647
49 -57.400[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  11  1MKASRKTRHTEMVCGVGWIGTEA-ILSAADDHVFLLTNTATNESQQILNMPETFF-SQTKGGQNDVFAVSTSDGKINILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGF-----VKMWSR-------SGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCY-IKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGFGQILFNSSVHDYPITSISWNTDGTLFAVGSHN---------------ILRLCD-KSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTYE... 304
50 -57.000[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  16  8....VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGLIADLRGHEGPVWQVAWAHPGNILASCSYDRKVIIWREENGT---------------------------------------------------EKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEEVKKINNAHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEDGQWKEEAHSDWVRDVAWAPSTSTIASCSQDGRVFIWTCDDAS----------SNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVD........ 294
51 -56.700[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  14  256....SQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIADITMPHRVSKVAFHPSGRFLATACYDSS-----WRLWDL------EQKTEVLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIAHTNLISDVKYQQEGSFLVTCSYDST--------------TKIWSNKTWQPLKTLQGHDNKVISVDIAPNSQYIATTSFDRTFKLWSPDS......... 553
52 -56.400[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  12  11....MLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPEAGLRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAAGPLQVEHAQEVYSVDWSQTRGEQLVVSGSW---DQTVKLWDP------TVGKSLCTFRGHESIIYSTIWSPIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRNVRVFELLGHTYAIRRVKFSPHASVLASCSYDFTVRFWNFSKP-------------DSLLETVEHHTEFTCGLDFSLQSPQVADCSWDETIKIYDPACLTIPA.... 323
53 -56.200[R] KOG4227 WD40 repeat protein  ali follow..  15  48....DLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQAKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVFAHEDAVYGLSVSPVNDNIFASSSD----DGRVLIWDIRE----SPHGEPFCLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFFNSCTMKSCCFAGDRDYILSGSDDFNLYMWRIPADP---EAGGIGRVVNGAFMVLKGHRSIVNQVRFNPHTYMICSSGVEKIIKIWSPYK......... 364
54 -56.100[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  12  11....SLRSPDGAVNSLCFQESD-RLLAGTIKGSVFLWDLQTNRSALHFEVGSDPITSLHHTPDR--LVTQEKGGTITMFSIGGSSYVKERSCRSALHTNTSKTNEQLLFYPCEESSIGVLHVT--DAAAPTQILVPDDPQLPKLGSVTCFKPFECASQLFLLAGYESGHFLTWDISSSVIL-DVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQLIKNPGVNGVRIRPDQKVFASAGWDGR--------------IRIFSWKSLRPLAVLTQHNGGVMDLAFSSQAPIMAAAGMDGQISLWDLYN......... 323
55 -56.000[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  15  357....VQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTTQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTG-----RWFVFDT------ETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCS-----------QFRAPSHIYGGHSSHVTNVDFLCEDSHLISGGKDTSIMQWRV........... 716
56 -55.300[R] KOG2055 WD40 repeat protein  ali follow..  12  209.DANFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSNFQPSMERFHVDPTGKYIALEGRSGH-----INLLHALTGQFATS--------KIEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRWQVQDGSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSNADAA-NITFSINSMSFSQDSQVLAIASRGK------------KDTLRLVHVPSFSVFRNWATPLGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAHYDLKFVPDK 526
57 -55.200[R] KOG1188 WD40 repeat protein  ali follow..  13  27........LGIDTSKTVQAGKENLVAVLCSNGSIRIYDKERLNVLREFSGYPGLLNGVRFANSCDSVYSACTDGTVKCWDARVAREKPVQYPSNIFISFDINCNDHIICAGTE-KVDDDALLVFWDARMNSSTTKDSLGAYSETHSDDVTQVRFHPSNNMVVSGSSDGLVNVFDINIDNALVTTCNSISSVSCIGWSGKGKQIYCMTHDEGFYWWDLNHLDTDEPVDALDYLIGGLYHEKTDHVIGGTNKGRIHLMNCSMSG-----------LTHVTSLQGGHAATVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKE 361
58 -55.200[S] KOG0283 WD40 repeat-containing protein  ali follow..  14  351.....VADKDVSDGSTDSPKKGKDHKHGKANEWVKVRELSALHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSMNGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGR--HVPETVFSFSDKPVCSLKGHLDAILDLSWSKSQL-LLSSSMDKTVRLWDIETKTCL-KLFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRHVVEWSDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEVTSADSRIRILDGSEVIHKFKGFRNTCSQLSASYSQDGKYIICASEDSQVYLWKNDFHRTRSTLTT 722
59 -55.100[T] KOG4378 Nuclear protein COP1  ali follow..  16  1............MMSNLVEPSWRLLAASGGD-TVKLFDVSADSVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTV-SAEECLSAISFSKKGSRYICSGGTG----QIVKIWDL------QRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRSPKMSWQHSAPTAGVCFSPSNEKIIASVGMDK-------------KLYTYDSGSRRSSSCI-AYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQPVTV.. 308
60 -54.500[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  17  93.QPEQCMFHDDWISSIKGAEEW--ILTGSYDKTSRIWSL-EGKSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVERLHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDQKTEQLGLTRTPIVTLSGHMEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGSLKSTL-TGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSSHTGWVTSVKWSPTHEQQLISGSLDN-------------IVKLWDTRSCKALYDLAAHEDKVLSVDWTDTGL-LLSGGADNKLYSYRYSPTT....... 418
61 -54.500[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  14  31....INSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGVPQRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFPSNTECIVTGSWDKT-----IKYWDMRQPQPVSTVM-------MPERVYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSQSLVYPVNSIAFHPLYGTFVTAGGDGT--------------FNFWDKNQRHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVI.. 349
62 -54.400[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  10  24....VIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQTHAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPSQAEPYAIFEHKQNVCCLHINEKATHMLSGSWDSN-----VIIWPITELN--SSSFTTIVCPGHTLSVWALASFPDLNTYLSASADKTIRMWF--GDTTLSVFKGHTDVVRALVVLSSSH-FLSAGNDGHIIHWDVASASILRKFATQAHEFIYSMTLSDSHILTTGEDGTLEFWAIDGGKDG-------NLAIVSEAVIQLPTTNTWDAKVLLNSD-IAVAGSDGRIYIMTTDKNRKADD... 329
63 -53.900[R] KOG1539 WD repeat protein  ali follow..  13  269...VIRDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSRELQRHISRRAKKLRLKEEELKLKPVVSFDCAEIREILKPCPENPTPIKGVFVSRNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQWDVGCSLVKIVYHRVNGLLATVADDFV--------------IRLYDVVTLKMVREFRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKQIDGVH. 617
64 -53.900[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  10  8..PSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSSYIVLSGGGGEGRS---IPNVILICRVDLHTN----SLSEQPIGRRVIGTDLPYRMAIHPRQGGLICALPNSCR---LFDWENIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASLKRNNSISAFNVSADGKLLAVGTLEGD--------------VLIIDSTKMQTNQIVKAHLGLVTALTFSPDSRCLVSVSFDSRARLTVIKQKGEKRRV.. 356
65 -53.900[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  14  128....AMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAFNFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMFSHKDEAIRGLAFAPTDVKFATASDDGT-----ARVWDF------ARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTPVKIWDPKSGSCLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYAHKKEVISLAWHPIHEGLFVSGGGDG-------------SIVYWMVDGEKEIGLLHAHDQAIWSMKWHPLGHILATGSNDNNTKFWARNFGLSNTNMIG 438
66 -53.300[R] KOG2444 WD40 repeat protein  ali follow..  12  1....MLVEFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVRCICHRSVPTAICTLPKSQQLATADESGE-----VKTWNLDP-EVASENANIRKWQEQDEDINDLKVDVKSNLLATSS-DGTLGAYDLRKAKLKMRSELMHSEL--YSVCGTNRSVYVGGEDGYVEVFNLNEYGNLLE-GFEMGVNGIVELRSGLLGLTSQGSNR--------------MRLLNVQPSKRLGYAGYHDDGIDAITISTDKSTVTMISMSCTIKKWDMGP......... 308
67 -53.300[R] COG2319 FOG: WD40 repeat  ali follow..  189.......RDDFYTSLLSWSPKGDLAIGL--AENIYLWSKELGP-TRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERVPRISIHHPGDIGVLAWKPETNRLLVGKGNGN-----IFVYDIIWSESSKAVLVATITNAHDEQVCGLTWNHDGSQFASGGNDNRVCLFKGSDLRQPLYVWQQNAAVKALSFCPWQRSLLAGSHDKHIRFYNCFNGKKIDELYCGAQITSIHWSPKYREFSVTFG--------YSLETVQHRFAVYSWPQLECLVSVLPPDIRCVHSVLTSQTDSIIIASSNETIKFFDLSEESSWHNSRV 508
68 -53.200[R] KOG2394 WD40 protein DMR-N9  ali follow..  10  126.GSFAASNSNTSMTNTNFDGKGTYLVFNVSDAFICDLNSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQ-SVNNRQDRCTSISWVPGGDGAFVVAHADGNLYNKDGATESVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDE-QPAPCKRDVPKLSPIIAHRVHTEPLSGLMFTQES--VVTACREGHIKIWTRPSESETQTNS. 522
69 -52.900[S] KOG2110 Uncharacterized conserved protein, contains WD40 repeats  ali follow..  10  2...........HFFVRKYRGKAALLSIGTFDG-YKIYNCDPFGKCFHKIQGATSIVEMLFSTSLVALVEKDDGNNLKLINTKKSTTICELTFPTPLLAVKLNRKRLLAVLEEQIYVYDISNMLLLHTIETTSPNSENCYLAYPDSRDHEPRTEGESSSPNVSNSAVSGQVILWDVINCKQITKIEAHKDSLACLAFNSDGTMLATASDNGRIRVFAIPSGQRLYQFSLPAQIYSIAFHPDSSLLTVTSSTQTVHIFRLKEVYSNLERQ-MLDPERDFAYAHIPGDKVTSIAAFGPDNTIVNVATYDGNLYSFRVNLRT....... 356
70 -52.300[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  15  1MWEAIKDRETGRIRSNSF---------ANRFKSRRILSLQLSNRKDFVSPHRGSVNSLQVDLEGRYLLSGAADGSAAVFDVQRATDYEASGLIAKHKCI-----------------------------------FTVDKQHENGHKYAISSAIWYPDTGLFITGSFDHYLKVWDTNTAQAVVDFKGKVYRTAMSSMAMSHTLIAAGTEDVQVRLCDIASGAFSHTLGHRDGVMSVEWSTSSEWVLYTGGCDG-------------AIRFWDIRRAGCFRVLDQS---QTQLGFRPPILKRTAVGSKVCS................ 254
71 -52.200[R] KOG2321 WD40 repeat protein  ali follow..  11  44IELLQDFEYPEASNRIKCTRDGKYAMATGVKPHIKVFDFAEMSLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFLNLEQGRFLNPLSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEIPSTVPSTPYSDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSDQGYSMPIKSLHWMDDGTARVLSADSKIIKIWEKDTGKPFSSIEPTVELNDVCPIEGTGLILTANEGSPMHAFYIPS-------------LNPAPRWCSFLDNITEEMEENPDDYKFVTKKELLNLGLDHLVGTGVIRAY.. 410
72 -52.100[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  12  39LQILQLYTCLDQIQHIEWSADSLFILCAMKRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEHLRITVWSLCTKSVSYIKYPKACLQGITFTRDGRYMALAERRDCKD--YVSIFVCSDWQLLRDGRLLSTYSAYEWSIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFANPKMGIGMLAFSPDSYFLATRNDNNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSR--------------LYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSMALLSKDHFCLCFLEVVGTACRQLGG 458
73 -52.100[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  13  26......ITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKEIEEKINKIRWCKRTNHFLLSTNDKTIKLWKLYEKNLKVVAAHAYHINSISVNSDAETYISADDLR------INLWNLSISDHSIVDIKPENMEELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSALKSFFSEIISSISDVKFSQNGRYILSRD-YLTLKIWDVNMKAPVKTIPLHDDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNN-LFVFS............ 461
74 -50.700[S] KOG0294 WD40 repeat-containing protein  ali follow..  10  40....TFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAH--------------------------------------------------AGQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNTLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHVMRRIEMPSKPICITWL-DGNECLTGLDNGNIAWISLKDE------------DDTPPTFILAHEVRVKAIAYL--NEFLATVSIAGQIKVWKIDMETRKLEEIA 299
75 -50.400[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  12  4ITCEIAWHNKEPVYSLDFQHGTARLASAGVDTNVRIWKVEKGEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNK---------EPEQIAFQDEDE----------------------AQLNKENWTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYSEDSVLLYDTQQSFPFGYVNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKE 386

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.