current user: public

If you have questions about the server, please let us know.

Query: [F] KOG1018 Cytosine deaminase FCY1 and related enzymes, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst METEYDQVLRSVAQVNIADQIGESDDVERDGNGVKVSCFTEVFDDVTIQFQIIRLAKQIYVWVGCNSAKFGSLYAAASTRPSNTVSVTSVLGGTSDNTGSGIARRLVLKTGLNIILACNIPKNNPLLEAKAEKVLIRKLIDLGYTMSKPAKLALEALEVPVGCVFLEDGKVIASGRNRTNETRNATRHAEMEAIDQLVGQWQKDGLSPSQVAEKFSKCVLYVTCEPCIMCASALSFLGIKEVYYGCPNDKFGGCGSILSLHLGSEEAQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNGNSSPFNLYTSIPLast
1 -107.000[F] KOG1018 Cytosine deaminase FCY1 and related enzymes  ali  100  1METEYDQVLRSVAQVNIADQIGESDDVERDGNGVKVSCFTEVFDDVTIQFQIIRLAKQIYVWVGCNSAKFGSLYAAASTRPSNTVSVTSVLGGTSDNTGSGIARRLVLKTGLNIILACNIPKNNPLLEAKAEKVLIRKLIDLGYTMSKPAKLALEALEVPVGCVFLEDGKVIASGRNRTNETRNATRHAEMEAIDQLVGQWQKDGLSPSQVAEKFSKCVLYVTCEPCIMCASALSFLGIKEVYYGCPNDKFGGCGSILSLHLGSEEAQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNGNSSPFNLYTSIP 311
2 -78.800[FJ] COG0590 Cytosine/adenosine deaminases  ali follow..  27  13...........................................................................................................................NPWSVILSASLFSAQDEQFMRRAIVLAAQAEAQGEVPVGAVLVRDGEIIAEGWNGSITNHDATAHAEIEVIRKAGKALSNYRLL---------DTTLYVTLEPCPMCAGALLHSRVKRIVYGAPDLKAGAAGTVMDLFSSQ---AAYHYATVEKGLLEEECRAQLQAFFQRRRKEIKAKRDAERKN.. 186
3 -35.300[F] COG2131 Deoxycytidylate deaminase  ali follow..  17  1....................................................................................................................................MNRISWDQYFMAQSHLLALRSTCTRL--VGATIVRDKRIIAGGYNVVEGHCIRTIHAEVNALLQCAKF-----------GVPTEGAEIYVTHFPCVNCTKAIIQSGIKKVYYATDYKNSPYAEELFR----------DAGVDVEQVELEEMILDRHNEEKLTFTADLLKRLAETGYDE. 171
4 -34.700[H] COG0117 Pyrimidine deaminase  ali follow..  24  2.........................................................................................................................................TDEQYMKLALALAESARQTSPNPVGAVVVKDGQIVGMGAHL----KAGEPHAEVHAIRMA--------------GEKAKGATAYVTLEPCS-CADLLIEAGVARVVIATEDPFPKVSGRGIRKLQQA-------GIEVEVGICKQEALDLNRIFFHFVR............... 143
5 -29.400[A] KOG2771 Subunit of tRNA-specific adenosine-34 deaminase  ali follow..  16  229..............................................................................................................................................EVTFTEDFKKDTTLRGIPKAYYDYLMNNEDYKDLTFGAEKSRECKEVDAVQGADNLAKFGPYLCT---------GYDIYLLQEPCLMCSMALVHSRAKRVFFVK-NSENGALATRFQLHSVRE---LNHHYEVFQFTTKEDEDL......................... 359
6 -29.300[F] KOG3127 Deoxycytidylate deaminase  ali follow..  15  302.........................................................................................................................NPEQINEIHNQSLPQEIARHCMVQARLLAYRTED----HVGAVIWAEGKFVGCGYNREIRKFRYIIHAEQNALTFRCQE-----------IKPEERSMIFVTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADSYMRFGELE-------GVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEE.. 502
7 -12.300[F] COG0295 Cytidine deaminase  ali follow..  19  4...............................................................................................................................................QELITEALKARDMAYAPVGAALLTKDGKVYRGCNIENAAYSMCNCAERTALFKAV----------SEGDTEFQMLAVAADVSPCGACRQVISELCTKDVIVVLTNLQ--------------------------GQIKEMTVEELLPGAFSSEDLHDERK......... 135
8 -10.000[F] KOG0833 Cytidine deaminase  ali follow..  15  25...............................................................................................................................................IRLPKLIRKAMSLARGPVGAVGRASSGRVYLGVNVEFPG-HHSIHPEQFLVTNLA----------LNSEKGLRQLAVAISSDPCGNCRQFLMETS......................................................................... 122
9 -8.940[C] COG0374 Ni,Fe-hydrogenase I large subunit  ali follow..  15  467....................................................................................................................................................GEFKGVGFLEAPRGMLSIKDGIIVPSTWNSGPRNFNDD-------VGPYEQSLVGTPIADPAKPLEVV--RTIHSFDPCMACAVHVVDADGNEVV.................................................................... 562
10 -6.930[C] COG3259 Coenzyme F420-reducing hydrogenase, alpha subunit  ali follow..  23  340....................................................................................................................................................VAGEGVGIVEAPRG-TLIHHYWTDEKGIVRGSNLIVATTH-NVRAINHVVGKVAERASDTRNLAEKVE--VAIRAFDPCMACATHAVNGVIPIEI--YRNYEESCCG........................................................ 451

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35