current user: public

If you have questions about the server, please let us know.

Query: [Z] KOG2046 Calponin, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MAVKAISSTQFNKGPSYRLLADVQNRLLPKYDSQKEAELRSWIKGFTGLSIRPDFQKGLKDGIILCTLVNKLQPGSVPKINGFRVELALARKPLQLPQGNGQLRHDPVDLFEANDLFESGNNMQVRVSLLALAGKAKTKGLRSGVDIRDKYSEKQNFDDTTMKASQCVIRLQITNKCASQSGMTAYGTRRHLYDPKNRILPPMDNSTISLQMGTNKCASQVGMTAPGTQRHIYDTKLGIDKCENSSMSLKMGYTQVANHSGQVFGLGRQIYEPKYLast
1 -109.000[Z] KOG2046 Calponin  ali  100  1MAVKAISSTQFNKGPSYRLLADVQNRLLPKYDSQKEAELRSWIKGFTGLSIRPDFQKGLKDGIILCTLVNKLQPGSVPKINGFRVELALARKPLQLPQGNGQLRHDPVDLFEANDLFESGNNMQVRVSLLALAGKAKTKGLRSGVDIRDKYSEKQNFDDTTMKASQCVIRLQITNKCASQSGMTAYGTRRHLYDPKNRILPPMDNSTISLQMGTNKCASQVGMTAPGTQRHIYDTKLGIDKCENSSMSLKMGYTQVANHSGQVFGLGRQIYEPKY 275
2 -59.500[Z] COG5199 Calponin  ali follow..  24  2......................VNTKNRCPGMDKQQKEVTLWIETVLGEKFEPTFHSLFKDGVRFCRFLNKVSPLDV-KYKESKQIFVQRENICSFINGLKKLRMNEYELFQTNDLFEAKDLRQVVICLYALSRQLQKERMFSGPFIHLATKSKIEFSQEVLDRSKYAIHLQMGSDPELSERSGGKGASNVMKDLRTNSL........................................................................... 182
3 -45.800[DT] COG5261 Protein involved in regulation of cellular morphogenesis/cytokinesis  ali follow..  16  10.LQSQAGAPVGTKGSNTRLAAKQRETLQAYDYLCRVDEAKKWIEECLGTDLGPTFEQSLRNGVVLALLVQKFQPDKLIKIYSNELQFRHSDNINKFLDFIHGIGLPEIFHFELTDIYEGKNLPKVIYCIHALSYFLSMQDLAPPL---IKSDENLSFTDEDVSIIVRRLRQSNVILPNFKALSADFMLRASPVSSRTPSPTRFPKHARFQTLNSSDSASEFSKKDASARSDILKMHRRTKSATPSLEQFNEPYKQTLPSHSIE............ 282
4 -17.700[Z] KOG0046 Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily  ali follow..  13  92..QARGVEKSGGSKGASSFLKTSTTTVHHAINESEKASYVSHVNNYLRDD--NAFFDLVKDGVLLCKLINVAVPGTIDE-KKTLNPWERNENLTLGLNSAKAIGCTVVNI-GTQDIAEGR........................................................................................................................................................... 223
5 -16.000[DZ] COG5217 Microtubule-binding protein involved in cell cycle control  ali follow..  11  10....................................TELLTWLNGLLNLNYKK---EECGTGAAYCQIMDSIYGDPMNRVKNATAEYEFQTNYKILQSCFSRHGIEKT--VYVDKLIRCKFQDNL---LQWLKKHWIR-------------HKDESVYDPDARRKYRPIITNNSATKPRTVSNPTTAKRSSSTGTGSAMSGGLATRHSSLGINGSRKTSVTQGQLVAIQAELTKSQETIGSLNEEIEQYKGTVSTLEIEREFYFNKLRDI..... 227
6 -15.900[Z] COG5069 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily)  ali follow..  13  80FNVLKKGVEGTEVKKGRITIKGSSSSVSHTINEEERREFIKHINSVLAGD--FEFFDQCKDGLILSKLINDSVPDTIQRNNKPLDNFKCIENNNVVINSAKAMGGISITNIGAGDILEGR........................................................................................................................................................... 217
7 -15.600[DZ] KOG3000 Microtubule-binding protein involved in cell cycle control  ali follow..  11  27.IPFRKHTVRGERSYSWGMAVNVYSTSITQETMSR-HDIIAWVNDIVSLNYTK---EQLCSGAAYCQFMDMLFPGCISKVKQAKLEHEYIHNFKLLQASFKRMNVDKV--IPVEKLVKGRDNLDFIQWFKKF---------------------DANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREI..... 275
8 -14.900[T] KOG2996 Rho guanine nucleotide exchange factor VAV3  ali follow..  20  2.................................EPWKQCAQWLIHC----LPTDLAQTLRDGVLLCQLLNNLRAHSINLLRPQMSQFLCLKNIRTFLTACCEFGMRKSELFEAFDLFDVRDFGKVIETLSRLSR............................................................................................................................................. 117
9 -14.300[Z] KOG0532 Leucine-rich repeat (LRR) protein, contains calponin homology domain  ali follow..  28  647.......................QNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVVS.......................................................................................................................................................................................... 712
10 -10.700[Z] KOG0035 Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily)  ali follow..  10  19...................EWEREGLLDPAWEKQQKKTFTAWCNSHLRKA--DNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSI--AEEIVDG-NLKMTLGMIWTI............................................................................................................................................... 131

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.