current user: public

If you have questions about the server, please let us know.

Query: [R] KOG2096 WD40 repeat protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450
# Score Template Links and tools%idFirst MDSVLVVGIASVILGALIAVLFFGSYFRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQNKRHHPLDLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFNRWEFTLQAHFHDLTVFFVCFLKFRFLRINLPAGGHPTAVAFADDASSIVVACHHMSGSSLYMYGEDKQKDQQGKLPLPSIKWDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKDGSVKEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKVFPIPLCDSGGNPLHYDRLSLCPEGKILAASHGSTLQWLCAETGNVLDTAEKAHEGDITCISWAPKAITVGERHAMVLGTSGDDKKVKLWEAPKSQSLLast
1 -110.000[R] KOG2096 WD40 repeat protein  ali  100  1MDSVLVVGIASVILGALIAVLFFGSYFRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQNKRHHPLDLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFNRWEFTLQAHFHDLTVFFVCFLKFRFLRINLPAGGHPTAVAFADDASSIVVACHHMSGSSLYMYGEDKQKDQQGKLPLPSIKWDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKDGSVKEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKVFPIPLCDSGGNPLHYDRLSLCPEGKILAASHGSTLQWLCAETGNVLDTAEKAHEGDITCISWAPKAITVGERHAMVLGTSGDDKKVKLWEAPKSQSL 454
2 -69.800[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  11  309.SVEWQPPVIDILSASMDKTMMIWRPEKKTCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSSKESEQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDEGNHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEGSFPEDLQADVQVLGANMSALGGGGEGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNELFSLCSDHKGNLVASSCKAQSIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQRTDNGEV-SHKLMAKVEAHKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQ-----------ILVLPPFGSSVTAVAWTGLDRCVAVGMSGLIELSNVKIIETEEEPFMCHVSAVNRLAWRPTEKCESNQSLRWLTSCGDDNCVRVFNFK..... 839
3 -68.800[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  13  398.ALTFPPSSGKSFIMGADEALESELG---------PGELAGLTVANEADSLTYDIANNKDALRKTWNP----------KFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKS------------------TSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYS----------------------GGTDGLIQGWNTTNPNLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLE-SNVDTTANSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGK--------------LIHSMVAHLEAVTSLAVDPNGLYLMSGSDCSIRLWNLESKTCIQEFTKKFEESIHDVAFHPSK--------CYIASAGADALAKVF........ 779
4 -68.700[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  15  101.CICFSPNGAFFAVAVQNVVLIFCAYNPFVLRRRFLGGFDDVTWLDWSSDSRLLAIGCRDSSTKIVAINYTK---NFRTYNLSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSLAPSDLEAERPKIAPPQRKKEKKAVSDNESEDDVENSTKEAEDVNHIKNEDETKSHPFFEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSISDYPISAALFNCTGDWVALASREGQLLVWEWQSEQYIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSF--------CFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRT--------------TSPNPAQFSCVAVDYSGELVVAGGQDDIFLWSVKTGKLLEII-SGHEGPVVSIAFSPVA------TSSTLVSGSWDKTVKIWNCLESNSE 558
5 -67.600[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  112.TLKYDQLGGRLASGSKDTDIIVWDVINESGLYRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLDTQH-----CFKTMVGHRTEVWGLVLLSEEKRLITGASDSELRVWDIAYLQEIEDEGRDRVVNLAVDKTGRILACHGTDSVLELIGGHRSDVRTLSFSSDNIAVLSAAADSEYALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLK--------FFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFGD--------------CHKSLFAHDDSVMYLQFVPKSHLFFTAGDHKIKQWDADKFEHIQTL-EGHHQEIWCLAVSPSG--------DYVVSSSHDKSLRLWERTREPLI 710
6 -67.300[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  113LVMEFNEEGHLLATGSADHIVKVWNLTEQQCTHTLKGP-SVVSAILFGKHEK-LVVGYIEGQLNLYNIMRGAPKK--LVNTWKSHNSHITALLQVPDSRVVVALSRDQTMSIHETETQETLRVPLYESIEGGAIGHNGVKEFVIETAKLVRKKRIASSNLDHLAYDVVSNRFLAISFHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLSTLVPVAAATGHANTVTALAISNTGRFLASVSTDCTIKLWGLGVSTK-QLPKLTCSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKMQLG-----------AGTLSGHRRGVGDVKFAKNSHKLASCSDMTIKIWNISEKSCLQTI-SGHSCAVFRVIFARNDSQ--------LISADSAGIIKIWTIKTADCE 600
7 -67.200[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  1..MEISSEDNNLMEKVLPPVEQVLTWTLIQICMQESDVELETKVKKYLRGEGANLETLKDKKLKTQLASREKL-----YGKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKQTDIANE---------------------VDILSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKRETVRDVAFLHNDQFFAAAQKKYAYIYGRDGT---ELHCLKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMVASIRTGKGRTDVMEVNPYNSVVGLGHSGGTVTMWKPTSQA--------PLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQT-----------------HSFHAKTLSFSQKGLLAAGT-GSFVQILGDSSGGSSHNYSMVKGYQIEKVMFRPYE--------DVIGIGHSMGWSSILIPGSGEPN 415
8 -66.200[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  12  8SVSFVSEDENELGGSGILVPVDISTNELQILCQLLGSSDDPVPISFFTTEGAEIVDSIRKSLEEIDFETTLKRPVTRCSASIPGHGEPVISAQFSPDGRGLASGSGDQTMRIWDIELELPLHTSHKSWVLCIAWSPDATKIASACKNGEICILKRHKQWITSLAWQPMHK-----------------DPTCRLLASCGKDGNIFIWDTVQGTVVRCLSGHTASVTCLRWGGEGL-IYSGSQDRTVKMWRADDGVMCRNMTGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQKVETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLWCGRTGK--------------YLASLRGHVGPVYQVAWSADSRLLVSGSDSTLKVFELKTKSLYYDL-PGHGDEVFTVDWSPEG--------TKVVSGGKDKVLKLWR....... 472
9 -64.300[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  15  6..........................PNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAP----------IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDC----------------------------ENVMAMSGHSGAVMEAHFTPDGSHIFT----------------------CSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQLLCSGSDDRTIKIWDARKKHAAHTLESP-FQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQA--------VLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQ------GHQHNFEKNLLRCAWSPGSDKITSGSDRHVYIWDVNTRRILYKL-PGHNGSVNAVDFSPKE--------PLILSGSSDKTLYLGEIDE.... 347
10 -63.800[S] KOG0295 WD40 repeat-containing protein  ali follow..  16  27.SFSVFLKESSLSENDIKPLGGILEKKWTTVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAADWIPRPP-----ETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETG-----------------------------QLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLS----------------------IKLWDFQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKS--------AKLVLRDHEHAVECVEWAPDTAYLFSGSRDRSIKAWNINTGD--------------VLFTLLAHENWVRGLAFHPKGKYLISVADKTLRVWELSAQRCMKAI-EAHEHFVSTVAFHQTS--------PFVITGSVDMSCKVWECR..... 404
11 -63.500[R] KOG0286 G-protein beta subunit  ali follow..  18  20.DARKACADVTLAEL--VSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNK-----VHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSRE-------------------------GNVKVSRELSAHTGYLSCCRFLDDNN-----------------------------------------------------------------IVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGT--------CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELIC------------FSHESIICGITSVAFSLSGRLLFAGYDFNCNVWDSMKSERVGIL-SGHDNRVSCLGVTADG--------MAVATGSWDSFLKIWN....... 340
12 -63.400[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  10  157.SADFRPARPRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEF---GSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEGTTVDDQQVSCLWQGDNLITVSLSGVIRVVKGHNKPITVLGLSDDRSTIYTGSGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYVVKLNCQPRGLAILRNENIIALACIKELTLVQDQKKIFSL----PIKYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGV-------LEPKVELDHLGAVTDVSYSPDLKYLVACDAHRKVVLYSVEEYKPAHN------------KEWGFHSARVNTVAWSPNSLLVASGSDTTIIIWSVANPAKHTIIKNAHPQSQITRLVWLDNNT--------VISTGQDCNTKVWHVEN.... 607
13 -63.400[S] KOG0282 mRNA splicing factor  ali follow..  12  211.EEQKELDEITAKRQKKGKQEEEK-PGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQ------IHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYG----------------------------ERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRY----------------------LKLWDTETGQCISRFTNRKVPYCVKFNPDEQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPV-------DFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNK---------KKIFKGHMVAGYACQVDFSPDMSYVISGDNGKLNIWDWKTTKLYSRF-KAHDKVCIGAVWHPH-------ETSKVITCGWDGLIKLWD....... 579
14 -63.300[A] KOG0285 Pleiotropic regulator 1  ali follow..  12  82.ALPGPKGSKELRKSATEKALVVGP-TLPPRDLNNTGNPGKSTAILPAPGSFSSTAALMERMPSRWPRPEWHAPWK-NYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATG-----------------------------VLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQ----------------------VKCWDLEQNKVIRSYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVL-PHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGK--------SMATITNHKKTVRAMALHPKENDFVSASADNIKKFSLPKGEFCH--------------NMLSLQRDIINAVAVNEDGVMVTGGDKGGLWFWDWKSGHNFQRASLESEAGIYAACYDQTG--------SRLVTCEGDKTIKMWKEDEDAT. 460
15 -62.300[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  11  245.DMMHQNDPNNQSPKLLKEFRKLHEPNAEDAPSRDYIPLPPHKGVDILSEVEAVKDWSKRLHLGPRASLPSV-----CMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKST----------------SVEDSDGSVRLLSHSGPVYGTTFSPDNKYLLSCSEDAS----------------------ARLWSVDTKTALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGH--------SVRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGR--------------RIKTMRGHRGNIYSLSFSRESTVLVSGGDCTVRAWDVFKTNYNNPV-SSSLTGSVVTPFSAKTSTFFTRRNLCLAISVS............... 643
16 -62.300[R] KOG0645 WD40 repeat protein  ali follow..  13  1..................................................................................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHV----------------------------IDGFHTRSIRRVAWRPIERPVLAVASFDSVVSINEKIDD-------------------DWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGD------DWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNEDVARPALQEEWKQQTSLPHIHKGAVYTISWMNDATLCSAGGDGKIVVYQREKHDAYEQDHAHGVYEINSLEYLRDDR---------LLSGGDDGECRVWSFK..... 322
17 -62.000[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  20.SVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTMDK-----VKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGW----------------------------ACTQIFEGHSHYVMQVTFNPKDTNTFA---------------------SASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYR--------LENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLGREIPVASMDNTG-ERLPLSVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALA------WRNRSFGSGLEFVWSSEGECAKIFGGTLLAMCSSD-FICFYDWAECRLI 459
18 -61.900[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  11  18CGVGWIGTEA-ILSAADDHVFLLTNTATNESQQILNMPETFPRSQTKGGQNDVFAVSTSDGKINILSRNGK------VENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSR------------------------------SGMLRSVLAQFATAVYCVAWDSTSSNVLYCNAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDG-FGQILFNSSVHDYPITSISWNTDGTLFAVGSHN-ILRLCD-KSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHVVTSSHIYIYSSKNWNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEGR----------KLINLNPPGQVMALLDERKIDLANDTLVVRDRADNVLHFFDPTTGKAQGDGNLKHEHDIVELTVNQCG----PLNDRNVAFRDQIGAVHIAMVKTFGVS 497
19 -61.900[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  13  233IAFSKSNGGTNLCADSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRSKDYSRTRKAKVVLCVTFSENGDTIT-GDSSGNILVWGKGTNRISYAAHEGGISPLCMLRDGTLVSGGGKDRKLISWIPEQFGPIRTVAEGKGDVILIGTGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPV-WDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNG----RKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEVFGVWPEGSDGTDINAVCRAHEKKLLSTGDFGKVHLFSYPCSQFRAPIYGGHSSHVTNVDFLCEDS-------HLISTGGKDTSIMQWRV...... 716
20 -61.600[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  10  24VPRNYDPALHPFEVPREYNATKLERVFAKPFLASLDGHRDGVNCLAKHPEKLAVLSGACDGEVRIWNLTQRN-----CIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLL---------------------GSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRADTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVY-------HTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGV------LTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMK-EARRRKEVNRIKHSKPG--------SVPLVSEKKKHV-VAVVK..... 445
21 -61.600[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  12  24.NDKLMDQGVTEDEAEQEQNDTMNNMVMDMSVQGFFEHKDSVFSVSINPVHSNCASGGGDDLGYIWDITTGE-----QICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFE-----------------------------FITAFETVDEIVWLSWHPKGLFLAA----------------------GCNDGSIWMWSLPSGKVVQVMYGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPECRMSSTAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSH--------ILASLEAQTESVEAIALCTALPICACASVDGTVALYDSASLKFRKS----------------PHEQAVIDCKFLPNTPYLLTACDCVIRKWDVRSGQLLGEY-TGHQEPILCMAITPDG--------KRVVTGSDDTELLVFDCEH.... 399
22 -61.400[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  12  25.AFTFGIESHISQSNINGTLVPPSALISVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSPSNKDVTSLDWNSDGTLLAMGSYDGFARI------------WTENGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMT-FASCSTDMCIHVCRLGCDHPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDA--------CVHDLQAHSKEIYTIKWSPTGPMLASASFDSTVRLWDVEQGV--------------CTHTLMKHQEPVYSVAFSPDGKYLASGSDKYVHIWNTQSGSLVHSYQ--GTGGIFEVCWNARGDK--------VGASASDGSVCVLDL...... 522
23 -61.100[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  13  407.AAAVVAYGRSPMVGFDPPPH--MRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHAR-----QINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKS------------------------PVSQLDCLNRDNYIRSCKLLPDGCTLIV----------------------GGEASTLSIWDLATPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQ---------LQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKP---------------DKYQLHLHESCVLSLKFAYCGKWFVSTGDNLLNAWRTPYGASI--FQSKESSSVLSCDISVDD--------KYIVTGSGDKKATVYEVI..... 769
24 -60.900[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  10  34.ALQYDAQNGRLFTGGSDTIIRTWSVPHHKDQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERDNKHG--FIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINA----------------------------NFKTVNNLIGCKDSIYSLATTPNLSLVLG----------------------AGTEKCIRLFDPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATCIAHEEGVWTLQVDSSFTTVYSAGKDKMVVKTPL--------YDFTKSQLLFKEEAPVKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQ--------------LSIGGDEDGPSTSNANHSVSASSSPPTFKYIRVKDQKGQQSTPELVIPGAPAIKKHAMLSDK--------RHVLTRDSDGNVALYDVLAARKI 426
25 -60.600[S] KOG0293 WD40 repeat-containing protein  ali follow..  13  195.GKESVNSRSKVLEELQTLLPASVIIPEKRLECLVNSLHIQRDSCVFHNTLDSDLSLYSDHQCGKHQIPSQ------TAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHI--------------------------SLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEV----------------------IRRWDVDSGDCVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVE----------RLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKIVS----------RYKGHKRSRFIIRSCFGGYKQAFIASGSDSQVYIWHRSTGKLIVEL-PGHAGAVNCVSWSPTNL-------HMLASASDDGTIRIWGLDRINQQ 567
26 -60.600[R] KOG2394 WD40 protein DMR-N9  ali follow..  10  75.TPTGTSSGYSASSGFRSATARLLGTGNGSRALSFVGGNGGGKSVSTSSRISGSFAASNSNTSMTNTNFDGNSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQD--VSKKLVGALHYNKDGS-------------VNNRQDRCTSISWVPGGDAFVVAHADGNLYNKDGATESTFPAIRDPTQFSVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRK--------VVAWGEGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDEIVVPLRRAPGGSPTPIIAHRVHTEPLSGLMFTQES-VVTACREGHIKIWTRPSESETQTNEANPTTALLSTSFTKDN--------KASLSSKIISGSTFKQ....... 556
27 -60.500[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  361.EWLKLKDEPHKRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNIDAEYLIPKLPSPRDLQPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRT------------------------------IETDEVVRCVAWCPNPKLSIIAVKTDDLLAEAPSQDVIESERIKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQE--------LVKKLLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLDLS-------------TKPYQTMRLHRNAVRSVAFHLRYPLFASGSDQAVIVSHGMVYNDLLQKLQTHEFGVLDVNWHPVQ--------PWVFSTGADSTIRLYT....... 784
28 -60.200[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  13  37.ELSMLVKADQCAPSERLLHVMIAGMQTSDKDKTNSDDVLPGIDLEFEPEASALAPEPHSYE----------------TAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMLAKSAPEDIEPGR-----------EQQGHPVIRTLYDHTDEVSYLEFHPKEHILAS----------------------ASRDGTVKLFDIAKPSKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGR--------CINTIAEAHGGICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGA--------GTTGKQEHQTEAVFNHTEDYVLFPDETTSLCSWNSRNGCRLTLNSLGHNGPVRYITHSPNG--------PAFLTCSDDFRARFWYRRANN.. 423
29 -59.900[R] KOG0289 mRNA splicing factor  ali follow..  12  66.PSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTR--------QELSHALYQHDAACRVIARLTKEVTAARE----ALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQLQDKATVLTTERKKRGKTVPERQVASHVGLHSASIPGILALDLCPSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERT--------NVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKT--------------QLDNNFEVKSLIFDQSGTYLALGGTD-VQIYICKQWTEILHF-TEHSGLTTGVAFGHHA--------KFIASTGMDRSLKFYSL...... 504
30 -59.700[T] KOG4378 Nuclear protein COP1  ali follow..  2MSNLVEPSWRLLAASGGD-TVKLFDVSADSGLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGT---KDGGDSAEECLSAISFSKKGRYICSGGTGQIVKIWDLQR-----------------------------KLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGD----------------------LIVHNLASGARATELKDPNGQVLLDYSRSSRHLLVTAGDDGTVHLWDTTGRSKMSWLKQHSAPTAGVCFSPSNEIIASVGMDKKLYTYDSGSRR---------SSSCIAYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQ-----------PVTVLHAFSNSEDVTSLSWQTSKPVIVNEKNYTSEM-TVEDSVVIPDPLPSTTPSASQSAMAPGSRGVYNDDMGVFSPIIDVSSVEKWADSEGYNN 440
31 -59.200[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  14  1...MGDQQQLILATGGYDHTIKVWQAHTGNCIKTMRVETSQVNALDRTPDKTRLAACGYQ-CIRLYDLESNCTA---PVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPPH----------------------------CSRIFDCEAPVNAACLHPNQVEIAM----------------------GSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQRPNRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKT--------DDFSKWRELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKS--------------SIRDYTGHTKAITALSFKDEIPVKSTNIDVQSSAKPPTQ-------RDNPPGTNNLAFFETVG--------RVAMNPYMGNTTTELN....... 362
32 -59.000[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  15  2.............................................................KIKLIDSVVRSFK---VAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKG-----------------------------TQSRTVNSKKYGVDLIHFTHANNTAIHS--------------------STKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLS--GRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVTFK---LNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQT-----------FTGYPNNKGIPIEASFSPDSQFIFSGSDGRVHIWNADTGNKVSVLNGDHPGPVQCVQFNPKY--------MMLASACTNMAFWLPTSEEG... 316
33 -58.900[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  12  46.VSSKSESGVSSSAVSDDEDDFMPDLPPGF--QMQQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKLIPAA-----CEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSM------------------------RYDKELLPAESHVINSLAFSPNGETLVVASGEAI---IRLLDRAGKQWSE-------TVRGDQYIIDLNITKGHTATVNCVEFNPNKNEFISCSDDGSLRLWNLDDHKVIKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQY-----VNVNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKE-----------PLLVKTGLENAFKSTDCGFSPRAEVVFTGTPGTLQFFDPMTFDLVYKI-DYPGISCHRIQWHPRLNQ--------IIAGLSDGTIHVYYDQTMSQR 453
34 -58.900[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  14  5................................................................................LLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNG-----------------------------ERLGTYMGHTGAVWCVDADWDTKHVLTGSADNS----------------------CRLWDCETGKQLALL-KTNSAVRTCGFDFGGNIIMFSTDKQMVSFFDLDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGE--------VLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKT----------------RTERPVNSAALSPNYDHVVLGGGQEARFFHLAFEEEFGRV-KGHFGPINSVAFHPDG--------KSYSSGGEDGYVRIHYFDPQYFE 320
35 -58.100[T] KOG0279 G protein beta subunit-like protein  ali follow..  17  7.............................................................................LKGTMCAHTDMVTAIATPVDNSVIVTSSRDKSIILWKLTKEDK------------------------SYGVAQRRMTGHSHFVQDVVLSSDGQFALS----------------------GSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECTISEADGHKEWVSCVRFSPNTLVIVSASWDKTVKVWNLQNCK--------LRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYS----------------EAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLNKTKVIYCTSLNWSADG--------NTLFSGYTDGVIRVWGIGR.... 325
36 -57.600[S] KOG1407 WD40 repeat protein  ali follow..  14  2..........................................................EETTIPFKSLH---------SREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHG-------------------------HSKAKDLELKGHTDSVDQLCWDPKHSDLVA---------------------TASGDKSVRLWDARSGKCTQQV-ELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRR-KFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSY--------PSLKPLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDM--------------LCLRTFTKLEWPVRTISFNYSGEYIASASDLFIDIANVQTGRTVHQIPC--RAAMNSVEWNPKY--------NLLAYAGDDKNPKYNTDEGVFRI 309
37 -57.400[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  13  2........AAIINQRVEQGESSMGG-AKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPS---IHHFMPVAPTSLYYSEETYKLLVGLINGNVYEFSVAD-------------------------DFNSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIV---------------------------CSENSNKMGSYLLENSCTAMVIDLPFVFVGDHGGHVTVLRIVDNQLVSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGR-------GEAYELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCQKCNQPFFRTCGSAVCGSCCDNWTTYPPMGETKIRICNDCNARMKDNIPHEIHTGITAMHLQETL--------GLLVTSGQNRVIMIWDVRSVCSA 410
38 -57.300[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  10  12.SVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKG-----CIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAG-----------------------------KLLHEFKCHEGPIRSLDFHPLEFLLAT----------------------GSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVICRDGVDMGWSTL-GDFCINEGKFIGCSYYRNSVGIWVSDISELEPYGA----VSEDKNECMVKRFSVLNDQSERMGSGPRGSVSP--------------------------DYETREIKNIYVDSTGGNLNVAQPGSLKATLPLESGKVATM---VSEKQNAAYFGPAGDKYSDSDSGEESSYSERESIPFSRTKSGMLL 378
39 -57.200[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  12  1..............................................................................MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQ----------------------------VKAHELKEHNGHITGIDWAPKSDRIVTCGADRN----------------------AYVWSQKDGVPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQV--------------STLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFIYDDRGCLTALETLHQNSITQVSIYEVD----KQDCRKFCTTGIDGAMTIWDFKTLESS 363
40 -57.000[R] KOG1539 WD repeat protein  ali follow..  13  236.ALSFSTDGRLLASGGSFGVISIWNLNKKRLQSVIDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNDGD-PRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSREQRHISRRAKKLRLKEEELKLKPERDWCNVVTCHMDTAEAYVWRLQNFVLGSRNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQWDVGC-SLVKIVYHRVNGLLATVADDFVIRLYDVVTLK--------MVREFRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKQIDG----------------HVDVPITALSLSPNMDVLATAHSDQVYLWVNQSSGLPSVESYASGKDVVNVKLPSVSAL--------TSSEADDDMDRQVLENSEA.. 698
41 -56.600[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  10  31.SVRISPKKPYHVATTSSVRLTLYDTVVCEPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVEKTTGSSKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAY-----------------------GVNAVPIIEIQAHEDAIRCGAVSSI---------------------NDHIVLTGGYDHKVRLWDIRSKEKSLEL-DCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGRQLTALQAHYKTVTSLRLATNSTCLLSAGIDRRVNAFRTTNYS---------LINSWSMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKKEA--------------TASAAIEDKRSLIRTSAPPVKLVEKDRDMQKVDVVAKNADKLKI-PKIDGMLSNFKHAAVIKLLFGGK---FRSAMDTAVVSYLRVIVMR.. 408
42 -56.500[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  12  57.....DEENEDTYETAAEKRLRL-EYLDEVKNELVEDGGFDAKEVDRELLASRLKEDVLEKKGQMYLDYTSKIVKIETAQLRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENNDDHEIGKAIKLHFR----PIKFSRSRRGENDHVKEITCLAISNDGRWIVT----------------------GGLDHRIVIRDSVTLEPQHCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSLDQMSYIETLFGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLVFRSGTSMKATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFT-GRHSAETSPDPVTIPPQPRWITSLAAIPYSNLFASGSDGNIRLWKIAEGLRSFEPLTSVYGCINSLSLSLQGKGK-QSEVRVFAACGRETRVGRWKTLRGI.. 499
43 -56.400[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  13  1....................MSATEL-PTKEAHILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRGI-----LIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTG-----------------------------RVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRS----------------------LRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDNLGQ--PVNCISISNDGNCVLAGCLDSTLRLLDRTTGE--------LLQVYKGHISKKTDCCLTNSDAHVIGGSEDGLVFFWDLVDAK--------------VLSKFRAHDL-VNSIDVDFYLRFFVAGDKRELPPEGRLYVDFFGRWYNSCLEKMKKQQILTSI--------DFVIYVSNSPFFFYYRL...... 343
44 -55.800[R] KOG2055 WD40 repeat protein  ali follow..  10  186.SVSYINQSSKLLAPGTINIKRLKDA------NFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDGKVNP---LVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSR------------------------MYGQENFQPSMERFHVDPTGKYIALEGRSGH----------------------INLLHALTGQFATSF-KIEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRWQVQDGSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSN--ADAAPKPVTTLDNITFSINSMSFSQDSQVLAIASKKDTLRLVHVPSFSVFRN-----------WPTSATPLGRVTCLAFGKGGELCVGNEAGRVGLWKLAHYDLKFVP---DKIINWEIRLGKFGYVLLGIQI---LILHVDVVI........... 555
45 -55.800[R] KOG0288 WD40 repeat protein TipD  ali follow..  14  153.TENKMLIDRWMLQKMQD--AERLNEANDLYEEMLAKLKANGLETLARQQVDGIVRRNEDGTDHFVESTIPST----CANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSG-----------------------------TLIKSLYGSLGNILDMAVTHDNKSVIAATSSNN----------------------LFVWDVSSGRVRHTLTGHTDKVCAVDVSKSSRHVVSAAYDRTIKLWDLHKGYCTNTV-LFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGK--------LLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGT------------ASGNRLASNWSRSCISPDDDYVAAGSDGSVHVWSLSKGNIVSIL-KEQTSPILCCSWSGIG--------KPLASADKNGYVCTWT....... 515
46 -55.600[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  14  37.PSKKHKLYDFLESRGKIETPRKRIVFEQLCKELLIRQLGGSRSHPFSTKTSRHVGGRLNLETYYSRPSE----------CLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQNEE------------------NQPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQT----------------------SKVFDLSTQQCITRLGYHSHSVKQVNFCNDSPNLVSCSRDGSIIFWDMRTHGITHENSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTVRPAATTPELTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRH---------NSGFCKTYKDPRLRISSFYVKLACSPDGATLACGGTSGVVVFDTTRNSSSAMLTGGHTKDVTAVDWSSEGQ---------LASISDDGSVRVWNSSLHGSA 471
47 -55.300[S] KOG0283 WD40 repeat-containing protein  ali follow..  13  316.RKFNSYLSKSVRLSKRRGAALLKNIKGVAHSLRVADKDVSDGSTDSPKKGKDHKHGKANEWVKVRPTGKSELSALHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQE-----------------------------CELMSMNEGSLTPIHPSLCDSSGNEITVVEKKKK----GKGSSGRRHNHIPDYVHVPETVFSFSDKPVCSLKGHLDAILDLSWSKSQL-LLSSSMDKTVRLWDIETKTCL-KLFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRH---------VVEWSDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSQT-----NQIDVQSNKKSQAKRKITSFQFSPVNPVLVTSADSRIRILDGSEVIHKFK--FRNTCSQLSASYSQDG--------KYIICASEDSQVYLWKNDFHRTR 717
48 -54.400[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  15  174.INKRQYEDEERKQQQREQDQATWYHEGPDSLRADYSLPRAKDRLVRAREALEVPSAARAGRMVEMQKKLQSLA---PLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDC-----------------------------ELKQTLRGHASYVGGVALRPGVK---------------ADEENVVAMASGGHDGAVKLWGFNNEESIADITGHPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGR--------CIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQ--------------PVYTIPAHTNLISDVKYQQEGSFLVTCSDSTTKIWSNKTWQPLKTL-QGHDNKVISVDIAPNS--------QYIATTSFDRTFKLWSPDS.... 553
49 -53.600[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  13  15.TLTIQPSTSSMQNSQPRIMNNHHHPHNRCENRLWQYGKQRILQQPDILYQQYAVPADSTPDVPVDCILTKF-----IRTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAF-----------------------------NFETILQAHDSAIRALKWASNEQWLLS----------------------ADQGGYVKYWQPNMNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTPVKIWDPKSGS--------CLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKE--------------MRTYRAHKKEVISLAWHPIHEGLFVSGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHPLG--------HILATGSNDNNTKFWARNRPG.. 422
50 -53.200[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  11  9...............................................................................SNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSSYIVLSGGGGEGRSGIPNVILICRVDSEQPIGRRVIGTDLPYRMAIHPRQGGLICALPNSCRL---------------DWENIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASA-------AIASLSKEKDEMFASCRFSVDNSVAANTQRGGSIITWDTTSWRRRS-------------SKLIKRNNSISAFNVSADGKLLAVGTEGDVLIIDSTKMQTNQIVKKAHLGLVTALTFSPDS--------RCLVSVSFDSRARLTVIKQKGEK 353
51 -53.200[R] KOG4227 WD40 repeat protein  ali follow..  15VGFLSQRGLHGDPLLTQDFQRRRLRGCRNLYKKDLLGHFGCVNAIEFSNNGGQLVSGGDDRRVLLWHMEQAIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDV------------------------------FAHEDAVYGLSVSPVNDNIFA---------------------SSSDDGRVLIWDIRESPHGECLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRL----PVFQFDNQGYFNSCTMKSCCFAGDRQYILSGSDDFNLYMWRIPADPEAGGIGRVV---NGAFMVLKGHRSIVNQVRFNPHTYMICSSGEKIIKIWSPYKQPGCTGDLDGRIEDDSRCLYTHEEREIEGWSSDSDSDLSESTILQLHAGVSER.. 453
52 -52.500[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  13  2........................SAVCGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDEAGLR----LFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAA----------------------------GPLQVYKEHAQEVYSVDWSQTRG--------------------------------------------------------------EQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPIPGCFASASGDQTLRIWDV--------KAAGVRIVIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRNV-------------RQPVFELLGHTYAIRRVKFSPHASVLASCSDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSP-------TQVADCSWDETIKIYDPACLTIP 322
53 -52.000[R] KOG1273 WD40 repeat protein  ali follow..  11  28.CVAFNHRGSLLAAGCADGGCVIWDFETRGIAKEIRDN---------------------------------------------DCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIAR------------------------------TILQQTPLQARLNPGLSSLCLACPLSSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQ-RSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVSSGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPATVGSKCLTLFREFQDTKMHWKAPCFSGDGEWVVGGSGEHKIYIWDRAGHL---------------VKILEGPKEALIDLAWHPVHPIIVSVSAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDE--------FDLIPETEKVKVLDVNEDEEV 395
54 -51.600[S] KOG4328 WD40 protein  ali follow..  11  135.RGKLVKGEIGVVKDENESPMVRTRSSSRVSKVSVKKEEPEDDSFSDYVNKEFSIPVKPEKIEFDLDLLTLEPQ-----NVARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGNE------------------------EDNDGIYLFTPHSAPVSSIVFQQNSLSRVI---------------------SSSYDGLIRLMDVEKSVFDLVYSTDEAIFSLSQRPNDEQSLYFGQDYGVFNVWDLRAGKSVFHWELHERRINSIDFNPQNPVMATSSTDGTACLWDLRSMGAKK----PKTLSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYH----------NNTSRWISKFKAVWGWDDSYIYVGNSKKIDVINPKLKRTVMELHNPLQRAICRIHCHPY-------NVGTLAGSTAGGQVYVWTTK..... 516
55 -51.400[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  12  46.QGSKRNLDEVTSASRKAYMTQLAVVMNQNRTRILAFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSERV----LDAPGLRDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSGSTSE---------------------------LVTIDEDKGPVTSINWTQDGLDLAV----------------------GLDNSEVQLWDCVSNRQVRTLRGGHE-SRVGSLAWDNHILTTGGMDGKIVNNDVRIRSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLAS--SKQTRQWLHRFEEHTAAVRALAWCPFQASLLATGGDGKIKFWNTHTGACLNS----------------ETGSQVCSLLWSQSERELLSSHGNQLTLWKYPSMSKMAEL-NGHTSRVLFMAQSPNG--------CTVASAAGDENLRLWNVFGEPPK 423
56 -51.400[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  11  51VEFDFLIKGQFLRMPEEVVEIEYVEKCTAPQPEQCMFHDDWISSIKGAEEWILTGS--YDKTSRIWSLEGKS------IMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVER-------------------------NKVKALHCCRGHAGSVDSIAVDGSGTKFCS----------------------GSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQL----------------GLTRTPIVTLSGHMEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGS---------LKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTK-----------DGSLVSLSLTSHTGWVTSVKWSPTHELISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGL---------LLSGGADNKLYSYRYSPTT.. 418
57 -51.300[R] KOG0646 WD40 repeat protein  ali follow..  12  2.......EITVIASSSIDEGIGSWDLKTGTEQLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSWTKPQ------AEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATG-----------------------------KLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGS---IRVWSLIRLFDDFQR--------QQGNTLYEHNFNEHTMSVTDIVIDYGGCVIISSSEDRTCKVWSLSRGKLLKNI-IFPSVINALALDPGGCVFYAGARDSKIYIGAINATSE---YGTQVLGSVSEKGKAITCLAYCADGNLLISGSEDGVVCVWDPKSLRH--------------VRTLIHAKGSRKGPVNNIQ-KTIVANSNKTQVSWKSRGALIPPPL----EKYERPVEDTMDGI--------VTVDPPPFSDVPVYSSFLSADL 380
58 -51.000[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  2.......................................................AGAGGGNDIQWCFSQVKGA----VDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQ---------------------------SHSRGEYNVYSTFQSHEPEFDYLKSL-EIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSNTFVYSSSKGTIRLCDMRASALCDRHSKLFPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYDKFECCWNGSD--------SVVMTGSYNNFFRMFDRNTKRDI 377
59 -50.800[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  12  2..SFFNRSNTTSALGTSTAMANEKDLAND--IVINSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGVP----QGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIG------------------------------MHSAPIKVLRFVQ------------------CGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPER-VYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHR--------------LKGYPTLQASIPVCSFNRNGSVFAYASYDWHQGHMGNRPDYPNVI---RLHATTDEEVKEKKKR............................. 365
60 -50.500[R] KOG2321 WD40 repeat protein  ali follow..  15.TVSGEGVTQRLPNWISKRKLKK-ALSHRIELLQDFEYPEASNRIKCTRDGKYAATGVYKPHIKVFDFAEMS-----LKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYS--------------------------------TRIPKYGRDLKYHYPNCDLYLAAAGDE----------------------VYRLNLEQGRFLNPLDSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSS-------PYMSKDQGYSMPIKSLHWMDDGTARVLSADSKIIKIWEKDTGKPFSS----------------EPTVELNDVCPIEGTGLILTANGSPMHAFYIPSLNPAPRWCSFLDNITEEMEENPAPTI----DDYKFVTKKELLNLGLDHLVGTGVI 407
61 -50.400[R] KOG1334 WD40 repeat protein  ali follow..  10  282.TIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNESGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINASYCE--NTKRVAKHRGPAHELALEPDSYKFLTSGEDAVVFTIDLRQDRP------------------------ASKVVVTRENDKKVGLYTISMNPANIYQFAVGGHDQFVRIYDQRRIDKKENNGVLKKFT--------PHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDGAQYVKRYKGHKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQ--------IIQFMEGRGDIVNCLEPHPYLPVLATSGLDQHVRIWTPTAK---------------TATELTGLKDVIKKNKQERDEDNLNYTDFDNRMLRFFVRH----LQRAHQPGWRDHGAEFPDEEE--------LDESSSTSDTSEEEGQDR... 675
62 -50.400[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  14  167.PNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLE-----CLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTG-----------------------------EVLNTLIHHNEAVLHLRFSNGL------------------------MVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQY--RDRLVVSGSSDNTIRLWDIECGA--------CLRVLEGHEELVRCIRF--DNKRIVSGAYDGKIKVWDLQAALDPRA-----PASTLCLRTLVEHSGRVFRLQFD-EFQIISSSHDDTILIWDFLNVPPSAQN-ETRSPSRTYTYIS.................................. 507
63 -50.300[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  12  13.LCKFSPDGKYLASCVQYR-LVVRDVNTLQILQLYT-CLDQIQHIEWSADSLFILCAMKRGLVQVWSLEQPE-----WHCKIDEGSAGLVASCWSPDGRHILNTTEHLRITVWSLCTKS------------------------------VSYIKYPKACLQGITFTRDGRYMALAERRDCKDYVSI-------------------FVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCLEYKIL-SLDGRLLSTYSEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKM-SLQTLKPVTDRANPKMGIGMLAFSPDSYFLATRNDNNAVWVWDIQKL---------------RLFAVLEQLSPVRAFQWDPQQPRLAICTGSRLYLWSPAGCMSV-QVPGEGDFAVLSLCWHLSG--------DSMALLSKDHFCLCFLETEAVV. 449
64 -50.100[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  14  7...............................................................................TVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGG----------------------------ILIADLRGHEGPVWQVAWAHPMY--------------------------------------------------------------GNILASCSYDRKVIIWREENGEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEGQWEVKK-----INNAHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEDGQWKE-----------EQKLEAHSDWVRDVAWAPSTSTIASCSDGRVFIWTCDDASWSPKLLHKFNDVVWHVSWSITA--------NILAVSGGDNKVTLWKESVDG.. 295
65 -49.400[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  11  10..............................................................................RELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNS------------------------------LKGEFLHGGAVLDCCFHDDFSGFSVGADYKVRR-----------VFNVGKEDILGTHDKAVRCVEYFDFSILFFYTLCLFCDVTGQVITGSWDKTVKCWDPRGASGPERTQTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQ------PEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRK-SEAGRDIVYPVNSIAFHPIYGTFATGGDGFVNIWDGNNKKRLYQY-SKYPTSISALSFSRDG--------QLLAVASSYTAIFVRSVNEIEV. 342
66 -49.200[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  14  17YSLDFQHGTARLASAGVDTNVRIWKVEKGPDGKAI----------------------------------------VEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKEPE--------QIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATDGN----------------------------------------------------------------LMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRK-----NLKRPIAHLPCPGKATLAVRCCPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDG--------AFLAISSTDGYCSFVTFEKDE.. 379
67 -49.100[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  15  14.DVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWE-------------------------------------------LSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDQEEC--------------------SGRRWNKLCTLNDSKGSLYSVKFAPAHL--------------------------------------------------------------GLKLACLGNDGILRLYDALEPSDLRSPANHLQSDFCLSWCPSRFEKLAVSALEQAIIYQRGKDG-----KLHVAAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSP--------------LASEESLTNSNMFDNSADVDMDAQGRSDSAELQSNLQVELLSEH-DDHNGEVWSVSWNLTG--------TILSSAGDDGKVRLWKATYSN.. 337
68 -48.800[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  1....................................................MDDIEDSLDQWKFAQCFGDKGDVE------ITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYL-----------KSLEIEEKINKIRWCKRTN--------------------RAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYNAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFQEDQDSKSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVDKFECTFSGDD--------KHVLSGSYSNNFGIYPTDSSL.. 374
69 -48.800[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  34.ALAVTQGGC-LISGGRDETVKFWAKKGKKTHAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPSQAEP-----YAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITELN-------------------------SSSFTTIVCPGHTLSVWALASFPDLPNTYL---------------------SASADKTIRMWF--GDTTLSVFKGHTDVVRALVVLSSSHFL-SAGNDGHIIHWDVASASILRKFATQAHEF-IYSMTLSDSHILTTGEDGTLEFWAIDGGKDGNL-AIVSEAVIQLPTTNTWDAKVLLNSD-IAVAGSDGRIYIMTTDKNRKADDD------------ILDAFDAEVVAKLTAKTERMKQEEHETVTIKVDIDDRPTQLNLKKGTDPGLCAQEFLSEN--------NLPIHYLEEITRFIKDRIPEA.. 413
70 -48.400[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  11  9..............................................................................VFSLRSPMGAVNSLCFQESDR-LLAGTIKGSVFLWDLQT-----------------------------NRSALHFEVGSDPITSLHHTPDR------------------------LVTQEKGGTITMFSIGGSSPGNHLGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPCFKPFECASQLFLLAGYESGHFLTWDISSSV---------ILDVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQ----------LGSELCIKNPGVNGVRIRPDQKVFASAGDGRIRIFSWKSLRPLAVLTQHKNGGVMDLAFSSQQVA--MWHAPIMAAAGMDGQISLWDLYN.... 323
71 -47.600[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  54.METSLAAEEEANGDEEEESVRVVDIEDTELTSNGNEAKPEDQELAIAPVLQYFQGALVELGRRCWTSST-------------EAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDLYSADTVQPARSLTKLQS--------------EVHVPEGGTVYDCVWYPHMN---------------SLQPETCLWLATRQHEPIHMWDAFDGSLRCSYSGYDMAAISLAFSHDGEQIYA-GYKRCIKIFDTSRPGRFCDDYPVKFAISCIAQTTAHPTLTCGNWHGYIQHFDLRCSH-----KQGPLFTLGGHKGGITQLRYGEFGNLFSGARKCDKILQWDMRNY-------------KQPLVELQRHVDTNQRIQFDSDSNWLASGDRGFVNVWDLKKYGDPSVL-PLHSDCCNGVALNPAMPILATSSGQNQKEVLYENAVVMWWCGQT... 486
72 -46.600[R] COG2319 FOG: WD40 repeat  ali follow..  10  154.TMVASEKDNKGKLNEKKNRSPENLLPFRILDAPELRDDFYTSLLSWSPKGDLAIGLAE--NIYLWSKELGP------TRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERV------------------------------PRISIHHPGDIGVLAWKPVLE--------------------------------------------------------------TNRLLVGKGNGNIFVYDIIAVLVATITNAHDEQVCGLTWNHDGSQFASGGNDNRVCLFKG--------SDLRQPLYVWQQNAAVKALSFCPWQRSLLATGHDKHIRFYNCFNGKKIDE----------------YCGAQITSIHWSPKYREFSVTFGHRFAVYSWPQLECLVSVLSVPDIRCVHSVLTSQLNETTGEMTDSIIIASSNETIKFFDLSEESSW 503
73 -46.500[S] KOG2110 Uncharacterized conserved protein, contains WD40 repeats  ali follow..  4FVRKYRGKAALLSIGTFDG-YKIYNCDPFGKCFHKIQGATSIVEMLFSTSLVALVEKDDGNNRKLKLINTKKSTTICELT----FPTPLLAVKLNRKRLLAVL---EEQIYVYDISNM-----------------------------LLLHTIETTSNVFAVCALSPNSENCYLA-----------------------------------------YPDSRDHEPRTEGESSSPNVSNSAVSGQVILWDVINCKQITKIEAHKDSLACLAFNSDGTMLATASDNGRIRVFAIPSGQ--------YQFRRGSLPAQIYSIAFHPDSSLLTVTSSTQTVHIFRLKEVYSN--------------LERQGLLPSSPPPKESLLRRSSRSLIGTVGGYLPQDPERDFAYAHIPGDKVTSIAAFGPDNTI--------VNVATYDGNLYSFRVNLRT.. 356
74 -46.300[S] KOG0294 WD40 repeat-containing protein  ali follow..  11  2......PPEMEIIEATNEELLLGFKLIKSELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRK-----QSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAH---------------------------AGQAVTHVSCHPSSKLALSLGGDQV----------------------LNTWNLVNGCVAHKTNTLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHVMRRIE-MPSKPICITWL-DGNECLTGLDNGNIAWISLKDEDD------TPPTFILAHEVRVKAIAYL--NEFLATVSIAGQIKVWKIDMETRKLEEIARSFM-----------DCRPTDLGLLDLRQFGNVRPEQRTKVEEKPKAKVESSAKPAAPRGFVTIEYEQDKKLD--------AEKKKEKKKNKKDEESSEES 384
75 -45.900[R] KOG2444 WD40 repeat protein  ali follow..  10  10LCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKR----VRCILKCHRSVPTAICTLPKSQQLATADESGEVKTWNLDPEVA------------------------SENANIRKWQEQDEDINDLKVDVKSNLLAT-----------------------------------------------------------------SSDGTLGAYDLRKAKLKMRSELMHSEL--YSVCGTNRSVYVGGEDGYVEVFNLNEYGN------LLERVESGFEMGVNGIVELRSGLLGLTSQGSNRMRLLNVQPSKRLGYAGYH--------GDEKSDDDGIDAITISTDKSTVFTSMSCTIKKWDMGP--IIDEIPILRAQDAKSKKMRKTE--------GFFDGLVGPKNDSDSDDDDEP.. 351

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.