current user: public

If you have questions about the server, please let us know.

Query: [R] KOG2615 Permease of the major facilitator superfamily, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440
# Score Template Links and tools%idFirst MKRLRRGFPFWELFTVWIIVLCTALPISSLFPFLYFMIDDFNIAKKEEDIGFYAGFVGCSFMLGRAFTSVAWGLVADRYGRKPVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAMEIFRDEYQGLALSAVSTAWGIGLIIGPAIGGFLAQPAKQYPSLFSQDSIFGKFPFFLPCLAISVFAFLVTIVSSRIPETLHNHKFNDDESYDALKDLSDDPESNKVAERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSPRKYGGLGYSTADVGSVLAFSGFGLLIFQLSLYSYAERLLGPIIVTRISGSLAMVVLSCYPLIAKLSGLALTVTVTSASVAKSVLGTSAITGLFILQNKAVRQDQRGAANGIAMTAMSLFKAIGPAAAGIIFSWSEKRQGAAFLPGNVNPNSCSCPCPCPSLNLast
1 -116.000[R] KOG2615 Permease of the major facilitator superfamily  ali  100  1MKRLRRGFPFWELFTVWIIVLCTALPISSLFPFLYFMIDDFNIAKKEEDIGFYAGFVGCSFMLGRAFTSVAWGLVADRYGRKPVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAMEIFRDEYQGLALSAVSTAWGIGLIIGPAIGGFLAQPAKQYPSLFSQDSIFGKFPFFLPCLAISVFAFLVTIVSSRIPETLHNHKFNDDESYDALKDLSDDPESNKVAERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSPRKYGGLGYSTADVGSVLAFSGFGLLIFQLSLYSYAERLLGPIIVTRISGSLAMVVLSCYPLIAKLSGLALTVTVTSASVAKSVLGTSAITGLFILQNKAVRQDQRGAANGIAMTAMSLFKAIGPAAAGIIFSWSEKRQGAAFLPGNVNPNSCSCPCPCPSLN 441
2 -47.700[R] KOG2816 Predicted transporter ADD1 (major facilitator superfamily)  ali follow..  11  6.........LGELRHLLVTVFLSGLAEYLIRPVMTDVTVAAGLDDSCSLAVYLTGVQQVTVGMGTMVMMPVIGNLSDRYGIKAMLTLPMCLSVLPPAILGYRRDTNFFYAFYVIKTL---------FDMAKNVHGTKRISMFGILAGVSSISGVCASLSARFLSI--------------------ASTFQVAAISLFIGLVYMRVFLKERLQDADDDDE--------ADSGGCRSHQEVHNGGDLKMLTEPILRDAPTKTHVFNSKYSSWKDMYFLKAR-----FGFNKNDFAELFLLVTIIGSISQLFILPTLSSTIGERKVLSTGLLMEFFNATCLSVAWSP--------VPYAMTMLVPGAMFVMPSVCGIASRQVGSSEQGKVQGCISGVRAFAQVVAPFVYSPLTALFLSENAPFYFPG-FSILCIAISLMIGFL. 389
3 -46.900[R] KOG2325 Predicted transporter/transmembrane protein  ali follow..  11  25.DKDDRLTNWRLIITAAVVSCLNAVENSVLGIGEWPYMREIDPNATAQ----FFGLATSASKCGHAVFALIFSIWSYKTSSKIPLIASRLIAIAACMIYLTTDKRYVLMAVYTLLGIANSGGTVLRGYVTLCSSNEDRPRAFAALGLSFIFSIIVGPTIQLIFSAIPYPGYEIIP---GIWFHLYSAPIWISFILTILTVFVILILIEDISREKKTKLRPSESQSSFSMERWRSL--YEKLKKSNLDWKLIVVCFFVRMAVSFSHSTLSTIGSILYMV------FGWDGATGSITMVIFGVMSSTILLYIFCHFGKILPQHKVFLFFTIAFGAVYIIYSWCSTALAVNPMLYLSVTILVAGMSIPIMSTALDTVYSRILGNIDQSVAHGAMAVIDDILYMITPIFTTTMFTL---------YGIGPLWIVKSMAFGIIAL. 477
4 -39.400[U] KOG3764 Vesicular amine transporter  ali follow..  13  94..........RDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQ------VGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAMGMLASYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYE----------------FVGKTAPFLVLAALVLLDGAIQLFVLQPS--------------------RVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMET-----MCSRKWQLGVAFLPASISYLIGTN-IFGILAHKMGRWLCALLGMIIVGVSILCIPFA---KNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKA---------IGFPWLMTIIGIIDILFAP. 465
5 -27.300[G] COG2271 Sugar phosphate permease  ali follow..  11  29...........QIFLGIFFGYAAYYLVRKNFALAMPYLVEQGFSRGD------LGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVSSIAVMFVLLFLCGWFQGGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAAL---------------YMPAFCAILVALFAFAMMRDTPQSCPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEV-----KHFALDKSSWAYFLYEYAGIPGTL-LCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPTVDM-ICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVASAIVGYTVD----------FGWDGGFMVMIGGSILAVI. 429
6 -26.300[G] COG2814 Arabinose efflux permease  ali follow..  11  29............VFAMSVCAFALIASEFLPVSLLTPMARDLQVTEGM------TGQGIAISGAFAVLTSLFISALAGSLNRKTLLLGLTLAMGVSGAIVALAPNYAIYMLGRALIGVVVGGFSMSAATAIRMVPKRDVPRALAIVNGGNALATVVAAPMGAYLST----------------VIGWRGAFLCLVPVSLIALAWQWKTLPSM-----------------PAAARAPGIGQVFKVFTLFKHPGVVVGMLASSLLFMGQFGLFTYVRPFLETVT-----NVHGATISLFLLVLGAAGFIGTVLI-GRVLQRSFYQTMIVIPVLMALTALALIAFGSS-----VAIVLVLLALWGLTGTSAPVGWWAWIAKVFPKDA--EAGGGLFVAVVQMSIALGSTVGGILFD.............................. 376
7 -25.400[G] KOG4686 Predicted sugar transporter  ali follow..  12  55............LVFMCLLGFGSYFCYDAPGALQNYFKKDLNLTSAQ------FTLIYSIYSWPNVVLCFVGGFLIDRLFIRLGTIIYMMILLVGQLIFGILDAFWMMILGRFIFGIGAESLAVAQSYAVLWFKGKELNMVFGLQLSVARFGSTVNFWVMQPIYE----------------YVSNFYKGHTALGVVLLLATLTCVMSMTC---ALILGWMDKRAERILQRNNNPAGQIPKLTDVFSFKPPFWMVSIICVAYYVAIFPFIALGQNFFVDR-----FGLSPAEANTVDSLVYLIAAVSSP-VFGFIIDKLGRNVTWVFTATLTTIGAHALLTFTQLTP-------YVGMIIMGLSYSMLAASLWPLVALIIPEYQLGTAYGFCQSIQNLGLAVITIVAGII----VDHSGGEHMWLQLFFMGWLTIALISTG. 445
8 -23.300[R] KOG3762 Predicted transporter  ali follow..  11  19..........RDAFICRLFYLSFFASFGSLFPLLAVYFKQLGMTAAQ------AGFLIGSRPIVEFLSGPFWSQFASRFRKKLLLLFSLGSLVLFTLGIGLEQAFMLLLILICLCEFFSAPAPLADAATLHSVRDNPAE--FGKIRLMASVGWGFAMFIMGIALDYSDTFRNHPCPAENTTEKNYTLCFVMCVIFMLAAMGLASKFKFDDDVPAPGEVHEKARARITQSEGGGGSENSLLLAMKALASMHILLFFVSVVVMGGGAGLVFSFLYWHLQD------IGGSPVLFGILSVVNHASEIIT-YFYVFKLINKYGHVRVMYLCLAVNFFRFMALSILD---------MVLPLQILQGACLATVWSCASSYISLVAPPHAKQHAQYALQVGHGIGKGLGSIIGGSVIS----------IGTRTTFVIYGLICLATCA. 553
9 -22.900[P] COG2807 Cyanate permease  ali follow..  14  16............IAGILMIATTLRVTFTGAAPLLDTIRSAYSLTTAQ------TGLLTTLPLLAFALISPLAAPVARRFGMERSLFAALLLICAGIAIRSLPSPY-LLFGGTAVIGGGIALGNVLLPGLIKRDFPHSVARLTGAYSLTMGAAAALGSAMVVPLALNGFGWQGAL---------------LMLMCFPLLALFLWLPQWRS-------------------QQHANLSTSRALHTRGIWRSPLAWQVTLFLGINSLVYYVIIGWLPAILISH------GYSEAQAGSLHGLLQLATAAPGLLI-PLFLHHVKDQRGIAAFVALMCAVGAVGLCFMPAH------AITWTLLFGFGSGATMILGLTFIGLRASSAHQAAALSGMAQSVGYLLAACGPPLMGKIHDAN---------NWSVPLMGVAILSLLMAI. 381
10 -22.900[R] KOG0253 Synaptic vesicle transporter SV2 (major facilitator superfamily)  ali follow..  12  27............LAYAGMGWVAEAMEMMLLSFVGPAVQSLWNLSARQE------SLITSVVFAGMLIGAYSWGIVSDKHGRRKGFIITAVVTFVAGFLSAFSPNYMWLIILRCLVGLGLGGGPVLASWYLEFIPAPSRGTWMVVFSAFWTVGTIFEASLA-WLVMPRLGWRWL----------------LAFSSVPSSLLLLFYRWTSESTENTHLLKAGESGEAVAVSKIVLKADKEPGFSLLALLSPTLMKRTLL-------------LWVVFFGNAFAYYGVVLLTTELNFIASFAEFPGLLISAAMVDRLGRKASMASMLFTCCIFLLPLLSH-------------FITTVLLFGGRICISAAFTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGILCPLVAVGLVH----------CHQTIAVLLFEVVILVSGI. 471
11 -22.800[P] KOG0252 Inorganic phosphate transporter  ali follow..  11  13...DAAKTQMYHFTAIVIAGMGDLFSISLVTKLLGRIYYHVDSSKKPGTLPNVAAAVNGVAFCGTLAGQLFFGWLGDKLGRKKVYGITLMLMVLCSLGSGLSFGMATLCFFRFWLGFIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILAGGIVSLIVSSTFDH--DPVGSTVPQADYVWRIVLMFGAIPALLTYYWRMKMPETARLIAEEEAQSNSNSSNPNFTFGLFTREFARRHGLHLLGTTTTWFLLDIAYYSSNLFQKDIYTAIGWIPAAETMNAIHEVFTVSKAQTLIALCGTVPGYWFTVAFIDILGRFFIQLMGFIFMTIFMFALAIPHWRHRENRIGFLIMYSLTMFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQ-KTDAGYPPGIGVRNSLLMLACVNFLGIV. 499
12 -22.600[R] KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)  ali follow..  13  106............VFQIMLLTCVTYMGSSIYTPGQEYIQEEFHVGHVVATLNL------SLYVLGYGLGPIIFSPLSERYGRLNLYMVTLFFFMIFQVGCATVHNIGGLIVMRFISGILCSPLATGGGTVADIISPEMVPLVLGMWSAGAVAAPVLAPLLGAAMVDAKN----------------WRFIFWLLMWLSAATFILLAFFFPETQHHNILYRRALKLRKETGDDRYYTEQDKLDRPLKMIIKEPAILAFVAYGCFYLFFEAFPIVFVGIYHFSLVEVGLAYMGFCVGCVLAY--GLFGILNMRIIVPRFRNGTFTPEAFLIVAMCVCWCLPLSLFLFGWTARVHWILPVISEVFFVLAVFNIFQATFAYLATCYPKYVASVFAGNGFCRASFACAFPLFGRAMYNLATKNYPVAWGSSLVGFLTLGLAIIPFIL. 532
13 -21.100[R] KOG2563 Permease of the major facilitator superfamily  ali follow..  10  49............LLAVALLNNTNTMSWIGYAPSGNYVNSFYGESS--------AAWLSMVYMMCTIPVGMFAMWAGREWGLRTAVLIAGWANGIGAVIRVISSRFPICMTGQGIAAIAYPFIMFLPTKVAGS-PDTQRAIATSIGVMSNPLGVLMANLISPAIVKSPEHVIWLN---------------IFTCVPSLIAMLIATFGVNRSEP-----------KIPPTFSASKPQMDFVSGMKSCFSSKQYIILLIVMGGGIGMFNCLYTVMLELLCP------SGYSNFFSGVCAALMIVGGVFGAAASSIFVDRTKLYEETLKIALGAAVIFGLIFLQLTLHQGYS--VILGVTCLLFGVLGLATYPIGLELASECTFPVSEATSTGLIVLSGQIQSVIYVFIMKNF................................ 412
14 -21.000[P] COG2223 Nitrate/nitrite transporter  ali follow..  11  27.QQRGHRVASRNLWISVPCLLLAFCVWMLFSAVAVNLPKGFNFTTDQ------LFMLTALPSVSGALLRVPYSFMVPLFGGRRWTAFSTGILIVPCVWLGFSTPFSTFIIISLLCGFAGANFASSMANISFFFPKQKQGGALGLNGGLGNMGVSVMQLVAPLVV-------SLSIFAAFGSHGVEQPDGSQLYLANAAWIWVP-------------FLAIFTLAAWFGMNELATSKASLKEQLPVLKRGHLWIMSLLYLATFGSFIGFSAGFAMLSKT-------QFPDVQILHYAFFGPFIGALARSA---AISDRLGGTRVTLINFVLMAIFSGLLFLTLPTGGVGGSFIAFYGVFLALFLTAGLGSGSTF-RAMREAATDTAAALGFISAIGAIGGFFIPKAFGSSLALT---------SPVGAMKVFLIFYIACVV. 451
15 -20.400[G] KOG0569 Permease of the major facilitator superfamily  ali follow..  11  1.......MPSLSIHILSIALCLIASVLNQPYAQIEQFINSTGHPISDSTLHLLWSLLNVCFPIATIFGQFLAGWMCSQFGRKHTALIAIPGALLCAAAKWCFPAFELLFVGRIIWSLANGNTVNATVWIVECAPPQIRGRMAAMQEFFMALGSLLTQAVGVPFSTDEL----------------WPYNFLPNCAVVVVSMVMFSWVAEICEQSIGKNKEKKKTAGGIESEHSGMEIMFMPWRAKDQTSRLIRYCAWVGVMVKIAY-VFTGARSLRGYSTFILYTLSHFTYSQATWLSFATGLLRLPFTLVPVFLVDRLGRRPLIIVSMLVSFVSILVMIIAININGELKYATFIGLTVLLLVNTCGIGSVSRFYAAELVPRNLLLSSVSTLTMFEALTKIG-YPTANVI................................ 444
16 -19.700[G] KOG0637 Sucrose transporter and related proteins  ali follow..  14  23.EDLGQPSPLRKIISVASIAAGVQFGWALQLSLLTPYIQLLGIPHKWSSYMWLCGPISGMIV----------GYHSDRFGRRPFIAAGVALVAVSVFLIGFAADMIFLTGFWFLDVANNTLQGPCRAFLADLADAKKTRVANACFSFFMAVGNVLGYAAGSY--------TNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTFSSLWYVKDKQWSPPQGDKEEKTSSLFFFGEIFGAVRHMKRPMVMLLIVTV-------INWIAWFPFILYDTDWMGREVYGGNQAGALGLMFNSILLGFVSLGVESIGRKMGGAKRLWGCVNFILHREIAGPLAGPSSGIKAGVFSLFTVLGIPLAITYSIPFALASIFSTNSGAGQGLSLGVLNIAICIPQMIVSFSSGPLDAQFGGGNLPSFVVGAIAAAVSGVLAL..... 492
17 -19.600[R] KOG0254 Predicted transporter (major facilitator superfamily)  ali follow..  11  35............VLVATLITFCHGIALGWLSPMLPKLLSPQETPLSFYIDVNEASWLGAVISIGGISGNFSFSYLMNRFGRKVSIYALAV----------PHTSIEWLYVARVFAGLTGGGMVVLPIFIGEIADNSIRGRLCSFFTLTMNTGIMVGFVVSSHIA--------YVLLATRYPEPPQQL---EEEAEKSLRYYRRCDGPNVSKEEERAYQKHFDEMRLAIQQQNNDTDDNGLSMSDFLTKRSLKALATGLVLMVANIFTGTFAFNNYMSNIFDAVHTQLDPNTNTIIIGAVQILGTLASIYLVDRYGRKVSCAGSGIGTSAFGLYAFYAEEQKVDLSAFSAWLPVTLMAFIIFIANVGVISVTMVVLVEILPQKIRAVATSFCLGCLSFFAFASLKTFPLMMF----------LGLAATMWFCAAVSVICLF. 456
18 -19.400[G] KOG2532 Permease of the major facilitator superfamily  ali follow..  10  41......................................................SLLFSGVAIGGLIGLVPSVPQISSIGLRNTQTISGFISGLGSFLFPLAVGFYTSFLCRVLQGIGAALFTAVGVVPGVWAPKSEANTFMSILACAFQLSNVICMPVSGLLCESAVGWRSIY---------------YISGAITFVLYTVFWFTYTDD----KLHRNVSQKELRKISTGKVEKIKEPVPYFAVSTDPTVIISWISLFGGNMGFYVLCIYGPTYLRE------LKFDVKETGFLTALPFILSAIAKF-SAGRISDKLTGLSE-RARFVFFASIFQIGLVAGLVVMAFTTNRVIAQIAFNFAIVSSGLNIMGVVKFADLPKNLIFVNLPICQFAGSFREILYKIETLKVRCLQHVHYTLTVMSFTAYASQFLSPTLVSII. 404
19 -19.100[P] KOG3574 Acetyl-CoA transporter  ali follow..  10  72.........LSSILLLLFLYVLQGIPL-GLAGSIPLILQSKNVSY--TDQAFFS-FVFWPFSL-----KLLWAPLVDAVGRKSWLVPTQYILGLFMIYLSTTPDVIALTVAFFLFEFLAATQDIVDGWALTMLSRENVGYASTCNSVGQTAGYFLGNVLFLALESADF----------------YLRFQPQPRGIVTLSDFLFFWGTVFLITTTLVALLKKENEVSVVKEETQGITDTYKLLFAIIKMPAVLTFCLLILTAKIGFSAADAVTGLKLVE------EGVPKEHLALLAVPMVPLQIILPLIISKYTAGPQPLNTFYKAMPYRLLLGLEYALLVWWTPKVEHYIVVLLSYALHQVTVYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWL................................ 470
20 -16.800[GEPR] COG0477 Permeases of the major facilitator superfamily  ali follow..  10  1MSTQLRNNPMKVALASMVGTAIEFFDYYIYAAAAVLVFNTQFFHSDDPLSNDLLSLSTALAFFARPIGSALFGHFGDKIGRKKTLVASLVLMGGSTVVIGLLPNY-LLCVCRVGQGILGGEWGGAALVATENAPEGKRAWYGTFPQLGAPIGLFVANGTFFLVSYLLGH--------NALVEWAWRIPFVSSILLVAVGLYV--------------RLTLHESHVFVEAEQKGKKLNAPVSVVFTKHLKPMVIGTFIMVATYSLFYIMTAFAQAYSRTAPKLSGLGIPANTF-TGLLLISAIVFGIFISISGFYADKIGRRKWLIWVTIAI--GVLGLAMPLFLENGTPVSVFAFLVIGMAIMGMTFGPMAALLPELFPTEVRYSGASLAYNLASIIGATIAAMISLKINASFGVMGVGIYLAINALMTFLALLAS..... 427
21 -16.800[G] COG2211 Na+/melibiose symporter and related transporters  ali follow..  13  3.......ISLTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDV--------VGLSVGLVGTLFLVARIWDAIIMGWIVNRWGKKPWILIGTLTNSLVLFLFEGTAQVVFVCVTYILWGMTYTIMDI--SLVPTITLDKREREQLVPFPR---FFASLAGFVTAGITLPFVSYVG--------RGFGFQMFTLVLIAFFIASTIVTLRNVHEVYSSDNGVTAGRPHLTLKTI-------------VGLIYKNDQLSCLLGMALAYNIASNIINGFAIYYFT--------IGDADLFPYYLSYAGAANLLTLIVFPRLVKMLSRRILWAGASVMPVLSCAGLFAMALADIHNAALIVAAGIFLNIGTALFWVLQVIMVADTVDYGEFK-RCESIAYSVQTMVVKGGSAFAAFFIALVLG.......................... 392
22 -15.400[E] COG3104 Dipeptide/tripeptide permease  ali follow..  10  32..........NAFYLIFSIEFWERFGFYGMQALTVYMVKIMGMDESA------SFVLFGAFSALVYGFVAIGGWIGDKVGTKRAITLGAIVMMVGYVLLGLSTAYIAMGFITVGNGLFKANPS---SLLAKIYPENDLDGAFTMYYMAINLGSFFSMIITPLVAI-AITVVNFLFCLRMLKGTGSPADLMPVNKMYLVLVAVGSIIASLVCSYLLQNLTLAHGILVVAGLFILGCYFKEAFSMSGIERAKMLVAFILMLQGVVFFVLYFQMPTSLNFVEHHIFGFDVAPEQFQALNPFWIMIASPILAATYGKLGDKLAMPFKFAFGMALCALSFLVLSWGTLFANEQGIISLIASYAFQSIGELLVSGLGLAMVAQLVPQRMMGFAMGMWFLTSASAAVIAGWVASLT................................ 457
23 -14.900[G] COG0738 Fucose permease  ali follow..  13  24...........ALTSLTLLFFMSGFITCLNDILIPHLKNVFQLNYTQ------SMLIQFCFFGAYFIVSLPAGQLVKRISYKCGIVVGLIVAAIGCALFASYRVYALFLGALFVLASGVTILVAANPYVTILGKPETAASRLTLTQAFNSLGTTVAPVFGAVLILSAATDATV-----------NAEADAVRFPYLLLALAFTVLAIIFAILK-------------PPDVQEDEPALSDKKEGSAWQYRHLVLGAIGIFVYVGAEVSVGSFLVNFLSDPT---VAGLSETDAAHHVAYF-WGGAMVGRFIGSAAMRYIDDGKALAFNAFVAIILLFITVATTGH------IAMWSVLAIGLFNSIMFPTIFSLALHGLGSHTSQG---SGILCLAIVGGAIVPLIQGAL................................ 382
24 -13.500[Q] KOG3626 Organic anion transporter  ali follow..  13  8............LGLFSFVFFLEAIGGSYINSAVQNIERQFQMSSRT------SGFMISASDFGYIPCVVFIAHFGSKGNRARWIGAGAILVSITYLMLASSYPFLVFFFSLLLLGIGRTVPWSL-PLLDDNIKKKSLPAYFGAISSIRVLGPICGYMIGSFCNK----YYTLNPPNGLTPADPWWMGFLFIGSIALFPSTMLFFFPQGKEGDGSAVQLRDVHKEKLKKSVDEDRTITMKSCKKVLSTKIYMGSVLGRVCDVLAFKGYIVFLPKYLENH-----FGIPQYLVHRYMAMFGVFGFGLGVATGGYVTKKLNGRRAAMFVMLMSTLNVCLYPVCDQTGFAYFSVIFFLTVLPGSFVAGLGVVPAMLILLRSVPPETRSLSLGLQGMAVSLFGTLSPILWGLVIDAA............................ 664
25 -13.300[S] KOG3097 Predicted membrane protein  ali follow..  44..........KNISIISIAFMVQFTAFQGTANLQSSINAK-------DGLGTVSSAIYAALVVSCIFLPTL---IIRKLTVKWTLVCSMLCYAPYIAFQ-LFPRFYTLVPAGILVGMGAAPMWASKAKITEQAVDAIIVRFFGFFFLAWQSAELWGNLISSLVLSSGAHGGGSSSNTTV-PEDEIFEISMIYLSCIVAAVCIIAFFLDPLKRYGEKRKGSNSAAELSGLQL--------SATFRQMKKPNLQLLIPITVFIGMEQAFIGADFTQAYVA-------ALGVNKIGFVMICFGVVNALCSI-LFGSVMKYIGRTPIIVLGAVVHFTLITVE-LFWRPNPDNPIIFYAMSGLWGVGDAVWQTQINGLYGLLFRRNK---------EAAFSNYRLWESAGFVIAYAYATTLCTQMKLYILLAVLTLGCIGYV.... 472
26 -12.300[R] COG2270 Permeases of the major facilitator superfamily  ali follow..  10  6.QNAETVVAKRGIWGWVMFDWAAQPFFTVVTTFIFGPYFVARLTDDPISAQATWSNMATVSSIIIALFSPILGSIADQSGRKPWIAFFAVIKIVSLFFLWFGSPIILPIICMILASIAEFSIVFNDSMMPRLTNPQNVGR---ISNLAWGLGY-LGGMVVLIAVVTLLASNPQTGLTIAGVKPLFGLDPATGEDARITGPLAALWYLVFILPMFLLTSDAEKGLPFAAAIRSG--GELKITLRELRYRPVLLRFLIARMLYQDGVNGVIILGGAFAAGM-----FGWATMEIGLFGILLNVVAIA--CFAAGRLDQKLGSRITILISLALLLLATVGIVSTEKGSTLFGWIQYLLYGVLIGLAFGPVQASSRSYLARNITVAEAGRYFGIYALSGRATSFMATLSFSIATTISGSAHIGMAT---LIVFLGAGFLLLLRVP 453
27 -11.900[G] KOG2533 Permease of the major facilitator superfamily  ali follow..  75.QKLRLKMDLRIIPCLWILYFLSCCLRFTV-SFTMNTAQGHSLIQTLSGYAHYLALGLALFYVGYIIFEVPSNLMMAFIEPR-QLTIGVVGACHAVL--TKHGNAQSYVALRFFLGVAEGLWPGLAYYMSRWYRGKHLGKRIGWY-----TAAQIAAAAVSLVSAGFQKMDGARG----LYGYQWMF--LIWGVVAIAQALSIPWWLPAVASKEHRTPADKSLHSRYIAEMNVGKRWQWSDLLKSCLDLRVWPFILMYFGIVGVGNGIFNYCTLIIEE-----NPSFSGID-ISLLNAPIWLADALGIVTVMPLYDRFHKKFSFFTGSCLIIIAGLAVANYAPRAW-----SRYGGLLMIGFGLGPTVPICMAWCSASMAKTYGDVGVASSLALVTGLGNLGSVVTTYALYSGWPGDPTFRKSNDVCIALIGVSIIACGI. 524
28 -11.800[H] KOG3810 Micronutrient transporters (folate transporter family)  ali follow..  10  34............TALLCAYGFFASLRPSE--PFLTPYLLGPDKNLTEREV---FNEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQGLLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILVS--------------VAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASFLMCYSSRPLLCWSVWWALSTYFQVVNYTQGLWEKVMPSRYAAIYN----GGVEAVSTLLGAVAVFAVIKISWSTWGEMTLSLFSLLIAAAVYIM------DTVGNIWVCYASYVVFRIIYMLLITIATFQIAANL-SMERYALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVS 477
29 -11.700[S] KOG3098 Uncharacterized conserved protein  ali follow..  10  82............FYAVTNVILGQKMPKSFVLESVIHSIHERTPKAIGKYAGYYGAVMYIIYMIGCLFS----PSILNEIGAKYILICSAICFASFPLGF-FFVNSYYYYFSQMLLGFGYALYYQGHGYLTSHSTRKTIESNINIAWCVGCICLLLSSGILATVTHMTLDSREIMQNLKNSTEFEPVERRFSDLEIKLLFGVFLGASVLGIVNFISCPGKDVTNCIQETKKKGTFMEG--KQTCSALTSKSMLQLFPLFTVLGTSSSFWLSIFTTAMNFTAANSN---LTYLAAIYPLSVGVGEIGTALFIMSRRFKDFSLQPTMLIGAIFSILGFGLV-HVSTPYDAPMRPTQEVPLLFGHSYLVISVIGVIVGIGDCCLNSCRSVICALRAQAFSISKLYQALGSCVLFFASPIIPLYVYTIGVSIHLIIANVFFN.... 505
30 -11.300[G] KOG4830 Predicted sugar transporter  ali follow..  10  8.DPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLS------PRDAAIVMLSGQVADAFATIFTGELVDEFGHKIWHAAGSLLVAISFSSV-----FGGCLPCSILHNDSLTLETFSYSMFAAIFNIGWAATQVANLGLYAIALVVFGVIKAGSKEDTETQ---------------YRWIAYSSITIGCCFVVIFLMGTKE----------------PRLRIDLKETSRARIPWVYWFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDD-----LQMDQSAKALVPAII-YICSFVVSVLLQEIPWNGKRLKAYYTAGGIIWIFCGAAILLLPRDISSF---MYAISVFIGIANALMMVTAISMQSVLVGAEV-AFVCGSLSFLDKMSCGLALYVLQSHQTTS............................ 381
31 -10.000[C] COG3202 ATP/ADP translocase  ali follow..  26..........KKFLPLAFMMFCILLNYSTLRSIKDGFVVTDIGTESISFLKTYIVLPSA------VIAMIIYVKLCDILKQENVFYVITSFFLGYFALFAFIVGKWSFASFYTIAELWGTMMLSLLQFANQITKIAEAKRFYSMFGLLANLALPVTSVVIGYFLH-------------EKTQIVAEHLKFVPLFVIMITSSFLIILTYRWMNKNVLTDPRLYDPALVKEKKTKAKLSFIESLKMIFTSKYVGYIALLIIAYGVSVNLVEGVWKSKVKELYPTKE----TIYMGQFQFYQGWVAIAFMLIGSNILRKVSWLTAAMITPLMMFITGAAFFSFTGILASSPLTLAVMIGMIQNVLSKGVKYSMAYIPLDKDLRVKGQAAVEVIGGRLGKSGGAIIQSTFFILFPVFGFIEATPYFASIFFIIVILWIFAVKGLN 486

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.