current user: public

If you have questions about the server, please let us know.

Query: [C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASVLast
1 -122.000[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali  100  1MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV 280
2 -101.000[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  62  1............MVELALPKNSQISEGKVWPKPDGAKNVREYRIYRWNPDD-GQNPRIDTYYIDVDDCGPMVLDALLYIKNNIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMEEIKG-TVKVYPLPHMPVVKDLVPDLSNFYAQHRSIEPWL--KTVSPTPAKEWKQSHEDRLKLDGLYECILCACCSTSCPSYWWNGDRYLGPAVLLQAYRWLIDSRDEATGERLDNLEDPFRLYRCHTIMNCAQACPKGLNPAKAIAEIKKMMVERRV..... 259
3 -33.300[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  16  1.................................................................................................................................................MVEPRDTVIREEDLNPDFLEELSELVEPVFEEEEVLSVQACYQCGTCTGSCPSGRRTS---YRTRLIMRKLQL----------GLVDEVIKSDELWMCTTCYTCYERCPRGVKIVDAVKAARNLAAKKGYMAKAH 122
4 -25.900[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  11  87..AATAEDATNYIKNVAKQKNAKKIVKSKSMVTEEIGMNHVLEAEGIKVVETDLGEYILQ--VAEDKPSHIVVPAIHKDRHQIEEMTLFIRETIRNDFLEADIGVSGCNFAVAETGSVCLVTNEGNLRLATSLPKTHIAVMGMERLAPTFKEVDVLITLLARSAVGA-DNGRSKMLGSEFREVLRCIRCGACLNTCPAYRQIGGHGYGSIYPGPIGSVISPILGGYEE--------KDLPSACSLCTACNQVCPVKIPLANLLLKHRRHIAESGMNP... 396
5 -24.100[C] COG0247 Fe-S oxidoreductase  ali follow..  15  125......................................VGWAFYRRYIEKLVRLKRGFKAGLVLIFIGGLMLTVLLGNGMNLIWHEHGLSWSEPIASGIA-GVGKTGAAVIFYIAWWIHLLFLLSFLVYVPQSKHAHLIAGPANVFFNRMESAGKLIDFTDETKESYGAGKIEDFRQSQLLDLYACVECGRCTNMCPATGTGKM--LSPMDLILRLRDHLTEKGAYNPSLIGDVITEEEIWACTTCRNCEDQCPVMNEHVDKIIDLRRYLVLTEGKMDS. 407
6 -20.600[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  18  12.......................................................................................................................................TFTQLRSLVMIFGHAFRKRDTLQYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETEDGRWYPEFFRIN------------------FSRCIFCGLCEEACPTT........................ 114
7 -20.400[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  11  1.......................................................................MSLTMRIFTASRNGQRLFGSHAAQRAEPKDIVEVPKGYVYVNNKELSMEFADITDRAASTMF--FGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDID------------------MTKCIYCGFCQEACPVDEGPNFEFSTETHEELLYNKEK... 194
8 -19.800[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  21  115.......................................................................................................................................................................................NNCIGCTKCIQACPV-----------------------DAIVGATRAMHTVMSD----LCTGCNLCVDPCPTHC....................... 161
9 -18.900[C] COG1146 Ferredoxin  ali follow..  20  31..........................................................................................................................................................................DRKEIEWYPTIDYDKCVTCGICFVTCGRRVFDFDKKEGKVIVARPYN------------------------CMVACQTCMNLCPTGA....................... 93
10 -17.700[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  20  42..............................................................................................................................................................................RTFMPVIDESKCVKCYICWKFCPE---------------PAIYIKEDGFVAIDYDY------------CKGCGICANECPTK-----AITMVREE........... 104
11 -17.500[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  14  380............................................................................................................................................................VKTAMKLAPIRKSLKKLPDIDEIIELASECTDCGWCQRVCPNS-------LPVMDAVKKAA----------DGDLSKLEEMAIEELCYTCGRCEQECERNIPIVSMVTKAGERRVKDEKYRIRA 486
12 -15.900[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  12  2....................................GAKVSVRI--------------NGEARDV-VEGTRILDYLNAEGIQH-PHICYSEQIGIQSCDTCMCEVDGELMRACSTNLTDGMEIKTNSELAKDAQAMDRILENHNGNCKVHNTTELLGVEKQDRPYREKGYLNDFTHPFYRYDPDQCILCGRCVEAC-------QQVQVNETLSIDWERSQPRVIWDDDRPANLS-------SCVSCGLCATVCPCNA....................... 205
13 -15.600[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  18  274.....................................................................................................................................................................................ISENCTMCNECAFVCPHAAIRPILTNEEEMESAPEGFMTREMRGKDGLRYRIQVSPM---DCTGCNLCAETCPAK---DKALVMKPFEEVAAKENP... 363
14 -15.500[C] COG0348 Polyferredoxin  ali follow..  17  219..................................................................................................................................................................................KVEHRQQCDNCMDCYNVCPE------------------PQVLRDPLHAKKSESPLVLSKD----CISCGRCIDVCPEKV....................... 275
15 -15.500[C] COG2080 Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs  ali follow..  14  31.......VSAATAAAAVVYPHSTLAASVPAATPAPEIMPLTLKV--------------KTEQLEVDT-RTTLLDALRE--------IGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITIEGLGSPDNLHPM--------------------------------------QAAFIKHDGFQCGYCT---------------SGQICSSVAVLKEIQDGIPSHVTVDLVTADEIRERMSGNICR--CGAYANILAAIEDAAGEI.......... 227
16 -15.000[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  10  65........................................................................................................................................................................VNAITRVDGAVQLNESLCVSCKLCGIACPEFSGSRPLDIPANANTPKAPPAPPAPARISTLLDWVPGIRAIAVKCDLCSACVRMCPTKALHLVDNTDIARVSKRKR...... 180
17 -14.800[C] KOG2282 NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit  ali follow..  16  1........MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFV--------------DGQSVMV-EPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVACAMPVMKGWNILTNSEKSKKARVMEFLLADQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFA-------SEIAGVDDLGTTGR--------GNDMQVGTYIEKM---MSELSGNIIDICPVGA....................... 230
18 -14.700[C] COG1145 Ferredoxin  ali follow..  16  275...........................................................................................................................................................................IAHSSYLATVDTSRCIACGICMLRCP----------------------MKAIKAKINREPASVDAE----KCLGCGVCVPTCPMELELPDGMTYVQELLADKG...... 361
19 -14.300[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  11  1MKDVFYTSTRAEVDLSAVRKLEKLIDESGVLDVVSKGDVVAVKTHFGDRGTTRTLR-------------SVFIRTVVEKVIEAGGRPFVTETTGLGMLRPRCTAVGRINIAEENGYTHQTLKAPIIIKHLNSVKVAKAIACDAVICCTHFKLVGGSIKNVGVGCVAKPSKFDIHMSDYPQIDEEKCTKCDECVKICPS------------------------------NAIEDYQINRE--KCVKCLGCSEACDYG........................ 242
20 -14.300[R] COG1453 Predicted oxidoreductases of the aldo/keto reductase family  ali follow..  10  66......LGRALADGYREKVKLATKLPSWMVKSREDMDKFLNAQLEKLKTD------HIDYYLIHNLSGETWVIDFFEKAKSDGTEGLKYAASKGLGVMGNLARTVPLAIENIWSEADVERTPVEWALRWVWNHPEVTVVLSGMNEE-VHIKENLKIASEAYPNSLTEAELQLVSKVEQKYRQIMKCTGCQYCMP-CPS----------PECFSIYNHLSTFGNAEDANLLYIGLLKPGMASQCVQCGQCLEKCPQHIDIPTILESVAEELEGSDLEE... 387
21 -14.300[C] COG1141 Ferredoxin  ali follow..  10  4.......................................................................................................................................FLPSPEQEDNRSGFEPELGGFLRDAPERSGFEPELGGILRQKGVYVDEITCIGCKHCAHVARNT------------------FYIEPDYGRSRVIRQDGDAEEVI------QEAIDTCPVDIHWVDY.................. 107
22 -13.500[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  13  159..............................QGGLNGIITLIINAAECEPYITADDRLMQEHADEV--TGIHILQVLIGIEDNKPEAIAALQRALRGQDDIHLRVVPTKYPSGGAKQLTKILTGKVLMQNVGTVVAIKRAVIDDEPLIERVVTLTGDALSSPGNKISNCILAPAETEMGLSEPEQSCIRCGLCVDACPAG-------LLPQQLYWFSR-----------GEEHEKARNHNLFDCIECGACAYVCPSNIPLVQYYRQEKAEIRALDQESARA 453
23 -12.900[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  16  2.............................................................................................................................................................................PPKIAEVIDYDVCAACGACEAVCPIGAVT----------------VKKAAGIRDPNDLSLYEKGGGYQVCEGCLTCSRVCPV......................... 67
24 -12.800[C] COG1600 Uncharacterized Fe-S protein  ali follow..  13  77..............TLRVISVRMNYLPANAAFASTLKDPTLGYVSRY--------ALGRDYHKLLRSRLKKLGEQIQQYCGSLNFRPPLAEKAGLGWTGKHSLILN---------------------REAGSFFFLGELLIDLPLPVDQPVE-------------------------------EGCGKCVACMTICPTGAIVEPYTVDARRCISYLT--IELEGAIPEAFRPLI--GNRIYGC----DCQLICP.......................... 259
25 -12.800[C] COG2440 Ferredoxin-like protein  ali follow..  16  7.............................................................................................................................................................KLRVEEKLYQNRYLVDPGRPHIKVRPHERPSALALTHICPA---------------KCYELNDKGQVETTSD------------GCMECGTCRVLCEAS........................ 80
26 -12.800[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  10  2.....................................LMATIHV--------------DGKEYEV-NGADNLLEACLSLGLDI-PYFCWHPALGVGACRQCAVKQYGRLVMSCMTPASDGTFISIDDEEAKQFRVVEWLMTEEGGNCHLQDMTVMTGHSFRRYRFTKRTHRNQDLGPFISHEMNRCIACYRCVRYY-------KDYADGTDLGVYGA----------HDNVYFGRPEDGTLESEFSGNLVEICPTGV....................... 207
27 -12.700[C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA  ali follow..  10  256........................................ELDVSRVVSLAGPQVKNPRLVRTVL---GANLSQLTANEVKDGENRV---------ISGS----LSGAKAAGPVDYLGRYALQVSVLEEGREKEFLGWIMPGANKYSLSRTVLGHFSKKLFNFTTALNGGE------------RAMVPIGAYERVMPL--------IIPTLLLRDLA-------AGDTDSAQAL----GCLELDDLALCTFVCPGKNEYGPLLRQALDKIEKEG...... 446
28 -12.500[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  15  8...................................................................................................................................................................................FIDSSRCTGCKTCELACQEDNGVWHQNVFAYYLSISCNHCDDPACTKVCPSGAMHKREDGF-VCIGCRYCHMACPYGAP...................... 114
29 -9.720[F] COG4630 Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A  ali follow..  15  2.................................AQASDSIRFIL--------------SEIVLSDVAPTSTLLDFLRLERRLTGT----KEGCAEGDCGACTVLVGRLAEDASGAKKLVYESVNACIRFTGSLNATHVVTVE-----------------------HLAAADGTLHPVQQALVDFHGSQCGFCT---------------PGIVMSLYGLWLADENPSRAAIEKALQG--NLCRCTGYEPIVRAAEA......................... 167
30 -9.540[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  13  457.......................................................................IPPLINAVYNHADFVLVILDNSTTGMTG-------HQPHPGTGFRGCGEAGKAVRIEDIVRGCGVEFVEVVNPYNVRKMVDV-AVVIARQPCAILWSRARRREGKIVTYKVTEDCTLCMECVNACPALIFDGE------------KVSIDQS------------------LCVGCAVCAKICPNRA....................... 616
31 -9.350[Y] KOG2439 Nuclear architecture related protein  ali follow..  14......................................................................................................................................................................................ISPALACVKPTQVSGG---------------KKDNVNMNGEYEVSTEPDQLEKVSITLSDCLACSGCITSSEEILSSQSHSVFLKNWGKLSQQQDKFL 97
32 -9.230[R] COG0727 Predicted Fe-S-cluster oxidoreductase  ali follow..  17  5....................................................................................................................................................KNNPIETRLTEVREELRDLKNFPDSKFVGIIKELGFRCELCARC---CTK-EFNDHVFLLDSDLEIIKQIDPYAVTPAPYYEFCDQNGRFYV-SCLENKRCRSICP.......................... 127
33 -9.080[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  13  2......................................................................................................................................................................NASTSSPSQQLQQAINSTIDKECAVCYSE----------MILPTTI-----------------------------SCKFCFICLKDCPI----------CRGPIDSQIFKKPLQ 77
34 -9.050[C] COG1140 Nitrate reductase beta subunit  ali follow..  11  197.....................................................................................................................................................................PSGAIYKREEDGIVLIDQDKCRGWRMCITGCP-------------------------------KKIYFNWKSGKSEKCIFCYVCSETCVGRIRYLGVLLYDADAIERAASTENE. 289

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.