current user: public

If you have questions about the server, please let us know.

Query: [R] KOG3135 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MPRVAIIIYTLYGHVAATAEAEKKGIEAAGGSADIYQVEETLSPEVVKALGGAPKPDYPIATQDTLTEYDAFLFGIPTRFGNFPAQWKAFWDRTGGLWAKGALHGKVAGCFVSTGTGGGNEATIMNSLSTLAHHGIIFVPLGYKNVFAELTNMDEVHGGSPWGAGTIAGSDGSRSPSALELQVHEIQGKTFYETVAKFLast
1 -91.300[R] KOG3135 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein  ali  100  1MPRVAIIIYTLYGHVAATAEAEKKGIEAAGGSADIYQVEETLSPEVVKALGGAPKPDYPIATQDTLTEYDAFLFGIPTRFGNFPAQWKAFWDRTGGLWAKGALHGKVAGCFVSTGTGGGNEATIMNSLSTLAHHGIIFVPLGYKNVFAELTNMDEVHGGSPWGAGTIAGSDGSRSPSALELQVHEIQGKTFYETVAKF 198
2 -34.500[R] COG0655 Multimeric flavodoxin WrbA  ali follow..  15  1M-KVLLINGSAKGCTYTALSEVAKALEEENIETEIFPVRGCIGCGTCSKTGSVFDDDTLNAGLEKAKTADGFIFGSPVHYAAASGALTSFLDRFFYAGKD--FAYKPGAAIVSCR--RGGAAAAFDQLNKYFTIANMPIV------------------SSQYWNMVHGNTPEEVKQDLEGMQTMRTLGKNMAWLLKSI 185
3 -27.000[CH] COG4635 Flavodoxin  ali follow..  17  1M-KTLILFSTRDGQTREIASYLASELKELGIQADVANVHR--------------------IEEPQWENYDRVVIGASIRYGHYHSAFQEFVKK-----HATRLNSMPSAFYSVNLVARKPEK............................................................................ 96
4 -24.800[C] COG0716 Flavodoxins  ali follow..  20  1MASVGIFFGSDTGNTEAIAKMIQKQLGKKLVHVQ----------------------DIAKSSKEDINNFDLLLLGIPTW-GEAQCDWDDFFPEL----EAIDFSTKLVAIFGCGDQED................................................................................ 93
5 -20.700[R] COG2249 Putative NADPH-quinone reductase (modulator of drug activity B)  ali follow..  14  1MSNVLIINHSKGALNLTLTNVAADFLRESGHQVKITTVDQ---------------GYDIESEIENYLWADTIIYQMPAWWMGEPWILKKYIDEVKGYGSGGLIQGKTYMLSVTWNA.................................................................................. 127
6 -19.000[I] COG1182 Acyl carrier protein phosphodiesterase  ali follow..  11  1MSKVLVLKSSILAGSNQLSDYFVEQWREKHSADEITVVGALRPSDAPLTTRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFI--------------------GITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVA..... 200
7 -18.200[R] KOG4530 Predicted flavoprotein  ali follow..  15  13..KILVIMGSSKRLCPTIATWVGEMGKRTNFDYEKVDLTD-DEPGLPIMGIDVYTQEHTKAWGSKIAGADGFVFVTPQYNGGYPAILKNALD-----HLYHEWNGKPLLIVSYGGHGGGDCASQLKHVAGFL-------------------KMRVAPTMPALTLPRDKIVQGVVDPAVEFTKHLGELKKAFGEFSQLF 192
8 -17.200[R] COG0431 Predicted flavoprotein  ali follow..  12  27IMSKKVLFIVGSLRQGSFNHQMALEAEKALAGKAEVSYLDYSALPLFSQDLEVPTHPAVAAAREAVLVADAIWIFSPVYNFSIPGTVKNLLDDLSDTRGVSALQDKFVTVSSVANAGHDQLFAIYKDLLPFI.................................................................. 164
9 -16.900[C] COG0426 Uncharacterized flavoproteins  ali follow..  14  269ETTVGLFYVADYGYSNLLVQAIGEGIQKTGVAVEMIDLSTA----------------EIQEIQELAGRAAGLIIGMPPTTSVAAQAGISSLLSV-------VKDKQAVGLFECFGGDDEPVDTIRRKF-------------------------------IDLGVKEAFPA--KDVPGASAYQLCTEAGTDLGQL.... 409
10 -13.500[F] COG1780 Protein involved in ribonucleotide reduction  ali follow..  1M--LIVYFSSATDNTHRFVQKLDLPNVRIPLTRVE----------------------------EPLKINEPYVLITPTY-SMTGENSRPVPPQVIRFLNDEHNRSFIRAVVAGGNSNFGSD............................................................................. 94
11 -9.930[C] KOG1160 Fe-S oxidoreductase  ali follow..  15  48.SRGKIFFISQTGTAKALAQRLHELCASNDIAFDIVDPHS---------------------EPEDLPKETLVLFIASTW-GKPPKNGEFLVNWLGESAEDFRVGSLLLSDC------------------------------------------------AVFGV-------GSRAYGESYNAVAKELSSRMIGLGGL. 171
12 -9.220[G] COG1440 Phosphotransferase system cellobiose-specific component IIB  ali follow..  16  1MKNILLI--GSGASSGFMAAAIRKAAKKRGEKVTVKAAS-------------------ESQIDERINEIDYLLIG-P-HLAYMLDDLKQKVADKD....................................................................................................... 73

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.