current user: public

If you have questions about the server, please let us know.

Query: [Z] KOG3155 Actin-related protein Arp2/3 complex, subunit ARPC3, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MPAFHSEIEDFQASVGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKSNIFFRTYEVKSEVDRVLIYITLYITECLKRLARCTSKSQGQQELYTLAISRFDIPGDAGFPLNGIYTKPEDPELMRQYFLQLRQETGNRLLEKVFDTPDGKPSKWWICFAKKKFMEKSLSGPGMLast
1 -113.000[Z] KOG3155 Actin-related protein Arp2/3 complex, subunit ARPC3  ali  100  1MPAFHSEIEDFQASVGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKSNIFFRTYEVKSEVDRVLIYITLYITECLKRLARCTSKSQGQQELYTLAISRFDIPGDAGFPLNGIYTKPEDPELMRQYFLQLRQETGNRLLEKVFDTPDGKPSKWWICFAKKKFMEKSLSGPGM 174
2 -5.790[R] COG2802 Uncharacterized protein, similar to the N-terminal domain of Lon protease  ali follow..  11  8MHVGNARYVKNDDLPKTVPVFPLPGALLLPEGHEPRYLAMIDTALASHRL-VQPALHVIEAGIEGGPLSAV-----CLGRITSFSETGDGRYVISLTGVCRFRLAGSEPYRSFRHAPFIADLSGEYDEEAVDRENLLRVFRAFL.............................. 159
3 -5.750[R] COG0780 Enzyme related to GTP cyclohydrolase I  ali follow..  15  2...............................................................DRLNVDIEDYGPPNPDYLSNVAQNLIEEMVEETLTSTLFPVTGQPDWASVTVRYFGVDHEGLLRYFISFREQCVERIFQDVLQRCSPQCLAVEARYTRRGGLDIN...... 118
4 -5.480[C] KOG0766 Predicted mitochondrial carrier protein  ali follow..  13  116...........ARAAVGFAFMPIKVRYESNLYSYTTIYSSIRDIWKKEGISGFFRGFTALRDAPHAGLYVYFYSKQNLHKLFDRFSPSSSVQGTVPHRNIVNVMSGLISGATATAITNPFDMLKTRVQLEPHIYKNFLHSAKLVYANE.......................... 259
5 -5.310[C] KOG3440 Ubiquinol cytochrome c reductase, subunit QCR7  ali follow..  12  38.....................................................YKKLGLK--FDDLIAEENPIMQTALRRLDESYARAYRIIRAHQTELTHHLLPRNE-------IKAQEDVPYLLPYILEAEAAAKEK................................... 117
6 -5.260[W] KOG3551 Syntrophins (type beta)  ali follow..  13  357LLLYDCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGS--HLFRVETHRDLSSWTRILVCHAAAELIKEVSLGCMLNGQEVRLTIH------ENGFTI--SRENGGSSSILYRYFERLKADDGIRNLYLDFGGPEGELTM--IVFVLHTFLSAKVTRMGL 538
7 -5.170[J] COG0180 Tryptophanyl-tRNA synthetase  ali follow..  11  30......NMQDDYHCIYCIVDQHAITVRQDAQQLRKATLDTLALYLAC-EKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFKDKSARYAENINAGLFDYPVLMAADILLYQTNLVPVGEDQKQHL--ELSRDIAQRF.................................. 164
8 -5.140[N] COG5461 Type IV pili component  ali follow..  36.................................................................LAVAMTALLVGCAQR-ITVGAIPDDYRTNHPIVIAEKNQKIDLPVGAGDRGMTGSQRDTLLGFLDGYDKSAAPTLTIQIPSGSANEV----AATAAGRDFARLAVASGV 141
9 -5.100[R] KOG2934 Uncharacterized conserved protein, contains Josephin domain  ali follow..  13  26..IYH-----EKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSNYDVNVIMAALQTKG--DKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWIC-GGAYYNLDSKLKMPEGESELRKFLKHHLRGKNCELL--LVVPEEVEAHQSWR................. 199
10 -4.970[C] KOG3382 NADH:ubiquinone oxidoreductase, B17.2 subunit  ali follow..  10  45.................................................GNKYYEDNKQFFGRHRWVVY-----------------TTEMNGKNTFWDVDGSMVPPEHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIWIPPSTPY........... 144

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.