current user: public

If you have questions about the server, please let us know.

Query: [O] KOG3259 Peptidyl-prolyl cis-trans isomerase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTELast
1 -91.900[O] KOG3259 Peptidyl-prolyl cis-trans isomerase  ali  100  1MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
2 -41.200[O] COG0760 Parvulin-like peptidyl-prolyl isomerase  ali follow..  16  209.VTDEELQAYYDEQMKVSFIAMDAAAMQSNITVTEEDIAAYYDQNRSSYTQPERRNYSVIQF---------------------KTEVEAKAALDELKKG-ADFAVIAKEKSTDISRNNGGELGWLEPETTPDEVK-AANLSEKGQLSDVIKSSVGYLIVRLND 357
3 -6.550[E] COG0549 Carbamate kinase  ali follow..  12  209..........................................DKDWASARLAEMIDADMLIILTAVEKVAINFGKENEQWLDRLSLSDAERFIEE---------------------------GHFAKGSMLPKVEAAASFARSRKAKEGIEGKTGTVICQ... 310
4 -5.940[O] KOG0549 FKBP-type peptidyl-prolyl cis-trans isomerase  ali follow..  12  1......................................................MKTAVIVGLLCLLAIAYAADEQKIDKLQIGVKKRAENCVQKSRKGDQLHMHYTGTLLDDSSRTRNEEFTFLGQGNVIKGWDQGLLNMCVGERRILIPPHLGY....... 108
5 -5.910[S] COG5451 Predicted secreted protein  ali follow..  12  97...................................................SEILGAVQYLRTLCPSSGPEDWRKSMSALLAADTASEPERRQRMTAAFNRGYRSFAAIHTSCTRAAIMAEENYRNEGA---------------TLAQEIASRFG........ 185
6 -5.680[S] COG2164 Uncharacterized conserved protein  ali follow..  13  3....................................................ERGVEMRLRIRFESAECEVELYEEWAPETVRAIADALPIKSTANRWGDEIYFTTQVAEENSKDVVELGDVAYWIPGKAICLFRPASAVNVIGRIVNSMEG........... 116
7 -5.650[J] COG0359 Ribosomal protein L9  ali follow..  11  50........................................................ARNYLIPKGLGVVATPGILRQVEQRRLKELERLKAEKDAAEARKVALETIGRFVIKKQVGEAEAIFGTVTTQEVADAVEAATQSLDRRGISLPDIHKTGFYQAQI.. 155
8 -5.430[S] COG4704 Uncharacterized protein conserved in bacteria  ali follow..  19  47..........................................................CVSIFTSSQGFPGDRKRVFDRQCTQINETPLKLTFNNLKAG--TYAVAAIQDLNGDGTLNRNDLGMFSRNPEVPKFGDAAFILAGRNTTIQVQMKK......... 150
9 -5.420[S] COG1849 Uncharacterized protein conserved in archaea  ali follow..  13  3..........................................................................EEELARKIERYFSIEEEALKKIRKIAEDNMQMILSYYSDAK--------FYAKGDLINAFAALNYSIDAGVRLGIFDGAGDHRLFTLYE 97
10 -5.230[A] COG5182 Splicing factor 3b, subunit 2  ali follow..  12  245............................................ERQLFELPSYIRATGI-----VQMRNAVHENEADMPLRQKMRERVQPKMGKLDIDYQKLHDAFFRYQTKPVLTGFGECYFEGK-----ELEADVKEKRPGDISEELREALGI....... 346

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.