current user: public

If you have questions about the server, please let us know.

Query: [A] KOG3408 U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MGRVARKRKHHSNGNHALFRTRVYGRDLDQIHNDLTESEKFDKLPIDPDLPGLGQHYCIECARYFDSSQALLVHKKGKVHKRRLKNLREEPYTQEEAEAAVNIGQPKQSVASKLADNSNVVMADLast
1 -62.300[A] KOG3408 U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing  ali  100  1MGRVARKRKHHSNGNHALFRTRVYGRDLDQIHNDLTESEKFDKLPIDPDLPGLGQHYCIECARYFDSSQALLVHKKGKVHKRRLKNLREEPYTQEEAEAAVNIGQPKQSVASKLADNSNVVMAD 124
2 -62.300[R] COG5112 U1-like Zn-finger-containing protein  ali follow..  100  1MGRVARKRKHHSNGNHALFRTRVYGRDLDQIHNDLTESEKFDKLPIDPDLPGLGQHYCIECARYFDSSQALLVHKKGKVHKRRLKNLREEPYTQEEAEAAVNIGQPKQSVASKLADNSNVVMAD 124
3 -29.500[R] KOG2785 C2H2-type Zn-finger protein  ali follow..  13  13FRDADMQRAHYKTDWHR-YNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQ. 134
4 -22.700[O] KOG0717 Molecular chaperone (DnaJ superfamily)  ali follow..  17  269..NQELANSYLNDKEAEAARLAHLIEVSLQMAED------YDTCSDECDEEGEELPYCVVCSKSFKTVNAKLNHENSKQHIRQLNELKKHMKEEDSTIFTEAEPKPDETPKGKKNKRKDRKKGN 384
5 -21.400[A] COG5246 Splicing factor 3a, subunit 2  ali follow..  15  64.....................................................GKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKSSLGREGQTTHDFRQQQKIIEAKQSLKNNGT 134
6 -16.700[A] KOG3454 U1 snRNP-specific protein C  ali follow..  19  1....................................................MPRYYCDYCDTYLTHDSP-KQHNAGYKHKANVRIYYQQFEEQQTQSL......................... 49
7 -16.000[JO] COG5269 Ribosome-associated chaperone zuotin  ali follow..  300..RKWEREAGARAEAEAKAKAEAEAKAKAESEAKANASAKADKKKAKEAAKAAKKKNKRAIRNSAKEADYFGDADKATTIDEQVGLIVDSLNDEELVSTADKIKANAAGAKEVLKESAKTIVDS 421
8 -15.500[R] KOG4727 U1-like Zn-finger protein  ali follow..  34  84.......................................................FYCDVCDCVVKDSINFLDHINGKNHQRNI........................................ 112
9 -15.400[K] KOG2482 Predicted C2H2-type Zn-finger protein  ali follow..  25  207..................................................KKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRK.......................................... 238
10 -14.600[A] COG5136 U1 snRNP-specific protein C  ali follow..  19  1....................................................MTRYYCEYCHSYLTTLSVRKSHLVGKNHLRITADYYRNKARDIINK.......................... 48
11 -13.600[A] KOG2837 Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing  ali follow..  18  1MGKHE-----------KDLANRTKSKGLQKL-----------------------KFFCQMCQKQCRDANGFKCHLTSEAHQRQLLLFAENS................................. 61
12 -13.400[A] KOG0227 Splicing factor 3a, subunit 2  ali follow..  14  1MDREWGSKSGQNEAIDRRERLRRLALETIDLAKDPY-------------RNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPTKPQPLKRNVSVRRTVK........... 109
13 -13.000[R] KOG2505 Ankyrin repeat protein  ali follow..  13  33....................................DSANLSNQGDIVDSTQKNISSCVNCQDNLHTLDERKSHIKSDWHRFNTKRKITKLPPVSQDEFESIIEDLPESLSGSESETNSESEED 121
14 -13.000[A] KOG0150 Spliceosomal protein FBP21  ali follow..  16  7...................................................SNERKFCDFCKCWLSDNKSVAFHESGKRHKMNVAKRITDISRNSEKSERE....................... 57
15 -12.800[R] KOG2295 C2H2 Zn-finger protein  ali follow..  16  793....................................ETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNK-HEEKVDEVRKE.................................. 845
16 -12.500[LD] COG5067 Protein kinase essential for the initiation of DNA replication  ali follow..  28  427........................................................YCENCCERYKD---LERHLGGKHHRR-FLLIRRPIRTN.............................. 474
17 -11.700[S] KOG4118 Uncharacterized conserved protein  ali follow..  15  1MARGQQKIQSQQKNQKKADAARK------------------AGIDQKAAAAKALNHKCTVCLAMMPDPKTYKQHFENK-HPKS......................................... 64
18 -11.600[A] COG5188 Splicing factor 3a, subunit 3  ali follow..  12  420......................................................EYRCEICSNKYNGRRTFERHFNEERHIYHLRELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTELELEEED 510
19 -11.000[A] KOG2636 Splicing factor 3a, subunit 3  ali follow..  17  405......................................................NYNCEICGNYYRGPKAFQRHFAEWRHAHGMRCLG-ANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYED 481
20 -10.900[KD] COG5189 Putative transcriptional repressor regulating G2/M transition  ali follow..  11  604.GCEKTYKNQNGLKYHRLHHQNQKLHENPDGTFSVIDPDSTDSFGDGMGSAKDKPYRCEVCGKRYKNLNGLKYH---RGH............................................ 680
21 -10.300[R] KOG4377 Zn-finger protein  ali follow..  20  459......................................................HYHCVTCDGGVLSRAQLAAHK--HRTGFPKQEADTTP................................. 493
22 -9.840[R] KOG2893 Zn finger protein  ali follow..  16  1MGRKKKKQLK----------------------------------------------WCWYCNRDFDDEKILIQHQKAKHHKETIDAVPNAIPGRTDIELEEGIPEKDMDERRRLLEQKTQESQK 106
23 -9.550[R] COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger  ali follow..  14  11................................................DRDGEEFLRCPRCGMVFKRRKDYIKHVNKAHGWLFGRGKPK................................... 51
24 -9.480[D] KOG2186 Cell growth-regulating nucleolar protein  ali follow..  15  107........KKHQEKANEVADMDYSKQQSEHPAVDKNNLTQQPDLDIYVGLSNDYPWFCSLCDINATSEQTLLAHANGKKHRVKVERFDAEQQKRQSTQHSTVDKKDYSKQQIEVDINVGLSNC. 221
25 -9.350[L] KOG3014 Protein involved in establishing cohesion between sister chromatids during DNA replication  ali follow..  44...QRRSAITERSEVLKGCIEKTLKKGSSSVPKNHKKKRNYTQFHLELGQSDFLLRHCAECGAKYAPGDELDEKNHQSFHKDYMYGLP.................................... 128

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.